DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and RHOD

DIOPT Version :9

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_055393.1 Gene:RHOD / 29984 HGNCID:670 Length:210 Species:Homo sapiens


Alignment Length:215 Identity:73/215 - (33%)
Similarity:104/215 - (48%) Gaps:31/215 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PHQELVKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVVD 73
            |....||.|||||...|||.|:...|.      .....::.|||:  ::|.:...        |.
Human    13 PGVRSVKVVLVGDGGCGKTSLLMVFAD------GAFPESYTPTVF--ERYMVNLQ--------VK 61

  Fly    74 GVNVSLRLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVIL 136
            |..|.|.:|||.|  |:|:.|...|..:.|:||||.:.||.|..|....||||:..||..||:|:
Human    62 GKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIV 126

  Fly   137 VGCKNDLRYMYRDENYLSYFGEKGTFVRAALKSDLVMPDEARAVAKELG-VAYYETSVFTYFGVN 200
            ||||.|||   :|::.::.....|.        :.|.....:.:|:.:| |||.|.|...:..|:
Human   127 VGCKTDLR---KDKSLVNKLRRNGL--------EPVTYHRGQEMARSVGAVAYLECSARLHDNVH 180

  Fly   201 EVFENAIRSALIARRQQRFW 220
            .||:.|...|| :.|.:.||
Human   181 AVFQEAAEVAL-SSRGRNFW 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 67/200 (34%)
RHO 16..211 CDD:197554 65/197 (33%)
BTB <392..446 CDD:295341
BTB 481..575 CDD:279045
BTB 485..582 CDD:197585
RHODNP_055393.1 Rho4_like 16..210 CDD:206704 72/212 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.