DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and Rhoj

DIOPT Version :9

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_001008321.1 Gene:Rhoj / 299145 RGDID:1310528 Length:211 Species:Rattus norvegicus


Alignment Length:217 Identity:67/217 - (30%)
Similarity:103/217 - (47%) Gaps:46/217 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVVDGVNV 77
            ::|||:|||.|||||.|:.:.|.:      .....:||||:  |.|.:        ...|.|...
  Rat    21 ILKCVVVGDGAVGKTCLLMSYAND------AFPEEYVPTVF--DHYAV--------TVTVGGKQH 69

  Fly    78 SLRLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVILVGCK 140
            .|.|:||.|  |:::.|..:|..:||.|:|||:.:|.|..|.:..|.||::...|.||.:|:|.:
  Rat    70 LLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQ 134

  Fly   141 NDL--------RYMYRDENYLSYFGEKGTFVRAALKSDLVMPDEARAVAKELGV-AYYETSVFTY 196
            .||        |.:|..|..|:|  |.|.                 .:||.:|. .|.|.|..|.
  Rat   135 IDLRDDPKTLARLLYMKEKPLTY--EHGV-----------------KLAKAIGAQCYLECSALTQ 180

  Fly   197 FGVNEVFENAIRSALIARRQQR 218
            .|:..||:.||.:....:::::
  Rat   181 KGLKAVFDEAILTIFHPKKKKK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 67/207 (32%)
RHO 16..211 CDD:197554 66/205 (32%)
BTB <392..446 CDD:295341
BTB 481..575 CDD:279045
BTB 485..582 CDD:197585
RhojNP_001008321.1 P-loop_NTPase 22..195 CDD:422963 67/207 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.