DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and RSA-14-44

DIOPT Version :9

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_872611.2 Gene:RSA-14-44 / 297173 RGDID:735071 Length:193 Species:Rattus norvegicus


Alignment Length:207 Identity:80/207 - (38%)
Similarity:108/207 - (52%) Gaps:30/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVVDGVNVSL 79
            |.|:|||.|.|||.|:..      .|..|....:||||     :..|...:|     |||..|.|
  Rat     7 KLVIVGDGACGKTCLLIV------FSKDQFPDVYVPTV-----FENYVADIE-----VDGKQVEL 55

  Fly    80 RLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVILVGCKND 142
            .||||.|  |:|:.|..:|..:||:|:||||.:|.|..|....|.||::.|||:||:||||.|.|
  Rat    56 ALWDTAGQEDYDRLRPLSYPDTDVLLICFSIGNPDSFGNIPHKWIPEVKHFCPNVPIILVGSKKD 120

  Fly   143 LRYMYRDENYLSYFGEKGTFVRAALKSDLVMPDEARAVAKELGV-AYYETSVFTYFGVNEVFENA 206
            ||   .|.|.:....::        |.:.|.|::.|.:|..:|. .|.|.|..|..||.:|||.|
  Rat   121 LR---NDLNTIQELAKR--------KQEPVKPEQGRDLANSIGAFEYVECSAKTKDGVRKVFEKA 174

  Fly   207 IRSALIARRQQR 218
            .|:||...|.::
  Rat   175 TRAALQTNRVKK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 77/197 (39%)
RHO 16..211 CDD:197554 76/197 (39%)
BTB <392..446 CDD:295341
BTB 481..575 CDD:279045
BTB 485..582 CDD:197585
RSA-14-44NP_872611.2 RhoA_like 5..179 CDD:206662 77/198 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.