DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and Rhod

DIOPT Version :9

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_001099793.1 Gene:Rhod / 293660 RGDID:1310985 Length:210 Species:Rattus norvegicus


Alignment Length:221 Identity:76/221 - (34%)
Similarity:105/221 - (47%) Gaps:38/221 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQPHQ-ELVKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWE 70
            |.||. ..:|.|||||...|||.|:...|      ......::.|||     :..|...|:    
  Rat    10 EAPHSGRPIKVVLVGDGGCGKTSLMMVFA------NGAFPESYNPTV-----FERYNATLQ---- 59

  Fly    71 VVDGVNVSLRLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVP 133
             :.|..|.|::|||.|  |:|:.|...|..::|:||||.:.:|.|..|....||||:..||..||
  Rat    60 -MKGKPVRLQIWDTAGQDDYDRLRPLFYPDANVLLLCFDVTNPNSFDNVSNRWYPEVTHFCKGVP 123

  Fly   134 VILVGCKNDLRYMYRDENYLSYFGEKG----TFVRAALKSDLVMPDEARAVAKELGVAYYETSVF 194
            :|:||||.|||   :|:..::...:|.    |:.|.        .|.||:|.   .|||.|.|..
  Rat   124 IIVVGCKIDLR---KDKVLVNTLRKKRLEPVTYHRG--------HDMARSVG---AVAYLECSAR 174

  Fly   195 TYFGVNEVFENAIRSALIARRQQRFW 220
            .:..|..||:.|...|| :.|...||
  Rat   175 LHDNVEAVFQEAAEVAL-SSRSHNFW 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 68/203 (33%)
RHO 16..211 CDD:197554 67/200 (34%)
BTB <392..446 CDD:295341
BTB 481..575 CDD:279045
BTB 485..582 CDD:197585
RhodNP_001099793.1 Rho4_like 16..210 CDD:206704 73/215 (34%)
RHO 20..192 CDD:197554 69/202 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.