DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and rho2

DIOPT Version :9

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_594569.1 Gene:rho2 / 2542773 PomBaseID:SPAC16.01 Length:200 Species:Schizosaccharomyces pombe


Alignment Length:224 Identity:75/224 - (33%)
Similarity:105/224 - (46%) Gaps:52/224 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MDNEQPHQELVKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWA--IDQYRIYKDVLE 66
            |...||.:.  |.|:|||.|.|||.|:..      .:|....:.:||||:.  :...|       
pombe     1 MLQSQPIRR--KLVVVGDGACGKTSLLSV------FTLGYFPTEYVPTVFENYVSDCR------- 50

  Fly    67 RSWEVVDGVNVSLRLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFC 129
                 |||.:|.|.||||.|  ::::.|..:|.::.::|:.|:|.||.||.|....|..||...|
pombe    51 -----VDGKSVQLALWDTAGQEEYERLRPMSYAKAHIILVGFAIDSPDSLENVSTKWIEEINTLC 110

  Fly   130 PDVPVILVGCKNDLR--------YMYRDENYLSYFGEKGTFVRAALKSDLVMPDEARAVAKELGV 186
            |:||.||||.|.|||        ...|::|:                   |...:|..||:.:|.
pombe   111 PNVPFILVGMKADLRSDPVAIEEMRRRNQNF-------------------VKSQQAELVAQRIGA 156

  Fly   187 -AYYETSVFTYFGVNEVFENAIRSALIAR 214
             .|.|.|..|..||::|||.|.|:||..|
pombe   157 RKYMECSSLTGDGVDDVFEAATRAALTVR 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 69/210 (33%)
RHO 16..211 CDD:197554 68/207 (33%)
BTB <392..446 CDD:295341
BTB 481..575 CDD:279045
BTB 485..582 CDD:197585
rho2NP_594569.1 Rho2 8..199 CDD:206702 72/217 (33%)
RHO 11..183 CDD:197554 69/208 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.