DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoBTB and Rnd1

DIOPT Version :9

Sequence 1:NP_001262107.1 Gene:RhoBTB / 40249 FlyBaseID:FBgn0036980 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_766200.1 Gene:Rnd1 / 223881 MGIID:2444878 Length:232 Species:Mus musculus


Alignment Length:254 Identity:77/254 - (30%)
Similarity:105/254 - (41%) Gaps:73/254 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DNEQPHQELVKC--VLVGDTAVGKTRL--ICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVL 65
            :...|...:|:|  |||||...|||.:  :.|:.|..        .|:||||     :..|...|
Mouse     3 ERRAPQPVVVRCKLVLVGDVQCGKTAMLQVLAKDCYP--------ETYVPTV-----FENYTACL 54

  Fly    66 ERSWEVVDGVNVSLRLWDTFGD--HDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRF 128
            |     .:...|.|.||||.|.  :|..|...|..||.|||||.|:.|.::.:....|..||..:
Mouse    55 E-----TEEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETMDSALKKWRTEILDY 114

  Fly   129 CPDVPVILVGCKNDLR--------YMYRDENYLSYFGEKGTFVRAALKSDLVMPDEARAVAKELG 185
            ||...|:|:|||.|||        ..::.:..:||  |:|.                 |:||:||
Mouse   115 CPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISY--EQGC-----------------AIAKQLG 160

  Fly   186 V-AYYETSVFT-YFGVNEVFENAIRSALIARRQQRFWMTNLKKVQKPLLQAPFRPPKPP 242
            . .|.|.|.|| ...::.:|..|.             |..|.| ..|:      |||.|
Mouse   161 AEIYLEGSAFTSETSIHSIFRTAS-------------MVCLNK-SSPV------PPKSP 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoBTBNP_001262107.1 RhoBTB 12..210 CDD:133275 68/213 (32%)
RHO 16..211 CDD:197554 67/210 (32%)
BTB <392..446 CDD:295341
BTB 481..575 CDD:279045
BTB 485..582 CDD:197585
Rnd1NP_766200.1 P-loop_NTPase 1..232 CDD:304359 77/254 (30%)
RHO 16..190 CDD:197554 68/223 (30%)
Effector region. /evidence=ECO:0000255 42..50 4/12 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.