Sequence 1: | NP_001262107.1 | Gene: | RhoBTB / 40249 | FlyBaseID: | FBgn0036980 | Length: | 783 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_502959.1 | Gene: | rho-1 / 178458 | WormBaseID: | WBGene00004357 | Length: | 192 | Species: | Caenorhabditis elegans |
Alignment Length: | 207 | Identity: | 83/207 - (40%) |
---|---|---|---|
Similarity: | 114/207 - (55%) | Gaps: | 30/207 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 KCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYKDVLERSWEVVDGVNVSL 79
Fly 80 RLWDTFG--DHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWYPEIRRFCPDVPVILVGCKND 142
Fly 143 LRYMYRDENYLSYFGEKGTFVRAALKSDLVMPDEARAVAKELGV-AYYETSVFTYFGVNEVFENA 206
Fly 207 IRSALIARRQQR 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoBTB | NP_001262107.1 | RhoBTB | 12..210 | CDD:133275 | 81/197 (41%) |
RHO | 16..211 | CDD:197554 | 80/197 (41%) | ||
BTB | <392..446 | CDD:295341 | |||
BTB | 481..575 | CDD:279045 | |||
BTB | 485..582 | CDD:197585 | |||
rho-1 | NP_502959.1 | RhoA_like | 5..179 | CDD:206662 | 81/198 (41%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |