DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ide and UQCR-C1

DIOPT Version :9

Sequence 1:NP_524182.3 Gene:Ide / 40248 FlyBaseID:FBgn0001247 Length:990 Species:Drosophila melanogaster
Sequence 2:NP_650401.1 Gene:UQCR-C1 / 41800 FlyBaseID:FBgn0038271 Length:470 Species:Drosophila melanogaster


Alignment Length:251 Identity:53/251 - (21%)
Similarity:95/251 - (37%) Gaps:19/251 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SQKSATRKPDSMEPILRLNNIEKSLQDTRDYRGLQLENGLKVLLISDPNTDVSAAALSVQVGHMS 71
            :.:|..|..|.::.......::|:|.:....:..:|:|||:| ...|.....:...|.:..|..|
  Fly    11 NMRSFMRGVDMIKRYKSAATLQKTLLNIPATQVTKLDNGLRV-ASEDSGASTATVGLWIDAGSRS 74

  Fly    72 DPTNLPGLAHFCEHMLFLGTEKYPHENGYTTYLSQSGGSSNAATYPLMTKYHFHVAPDKLDGALD 136
            :.....|:|||.|||.|.||.| ..:......:...|...||.|....|.::.......:..|::
  Fly    75 ENEKNNGVAHFLEHMAFKGTAK-RSQTDLELEVENLGAHLNAYTSREQTVFYAKCLSKDVPKAVE 138

  Fly   137 RFAQFFIAPLFTPSATEREINAV---NSEHEKNLPSDLWRIKQVNRHLAKPDHAYSKFGSGNKTT 198
            ..|..........:...||.:.:   ..|.|.||...::            ||.::....|....
  Fly   139 ILADIIQNSKLGEAEIARERSVILREMQEVESNLQEVVF------------DHLHATAYQGTPLG 191

  Fly   199 LSEIPKSKNIDV--RDELLKFHKQWYSANIMCLAVIGKESLDELEGMVLEKFSEIE 252
            .:.:..:|||..  :.:|..:.:..|.|:.:.||..|....|:|..:.......:|
  Fly   192 QTILGPTKNIQSIGKADLTDYIQTHYKASRIVLAAAGGVKHDDLVKLACSSLGGLE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IdeNP_524182.3 Ptr 25..952 CDD:223956 50/233 (21%)
Peptidase_M16 47..185 CDD:279066 29/140 (21%)
Peptidase_M16_C 211..386 CDD:282978 9/42 (21%)
Peptidase_M16_M 395..676 CDD:292805
Peptidase_M16_C 680..863 CDD:282978
UQCR-C1NP_650401.1 PqqL 35..459 CDD:223685 49/227 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445071
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.