DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ide and AT3G57465

DIOPT Version :10

Sequence 1:NP_524182.3 Gene:Ide / 40248 FlyBaseID:FBgn0001247 Length:990 Species:Drosophila melanogaster
Sequence 2:NP_001327018.1 Gene:AT3G57465 / 28719409 AraportID:AT3G57465 Length:100 Species:Arabidopsis thaliana


Alignment Length:67 Identity:17/67 - (25%)
Similarity:26/67 - (38%) Gaps:17/67 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   655 SIYY-------LALLLTENAW----------ANMELLDAMELVTYDRVLNFAKEFFQRLHTECFI 702
            |.||       ..|.|::|.:          ..:|.|||:..:..:.:.||......|...||:|
plant     7 SSYYAQVAGLHYRLSLSDNGFELSLVGFSQKLRIEKLDALSFLKAEDLANFVPMLLSRTFVECYI 71

  Fly   703 FG 704
            .|
plant    72 AG 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IdeNP_524182.3 Ptr 25..954 CDD:440648 17/67 (25%)
AT3G57465NP_001327018.1 Peptidase_M16_M <8..>40 CDD:465051 5/31 (16%)

Return to query results.
Submit another query.