DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-9 and AT1G31540

DIOPT Version :10

Sequence 1:NP_649214.1 Gene:Toll-9 / 40245 FlyBaseID:FBgn0036978 Length:900 Species:Drosophila melanogaster
Sequence 2:NP_001117396.1 Gene:AT1G31540 / 840044 AraportID:AT1G31540 Length:1161 Species:Arabidopsis thaliana


Alignment Length:116 Identity:20/116 - (17%)
Similarity:44/116 - (37%) Gaps:37/116 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   495 SEVMTCRMHDLMREV----CLQKAKQESFVQVIDSRDQDEAEAFISLSTNTSRRIS--------- 546
            ||:...:..|:||.:    |.:..:|.|.|:::.....|:|           ||:.         
plant     8 SELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKA-----------RRLGYKAKQGFVV 61

  Fly   547 --VQLHGGAEEHHI-----------KSLSQVSFRKMKLLRVLDLEGAQIEG 584
              |::..|..:..:           :.::|:.|::.|.....:..|.::.|
plant    62 YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGG 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-9NP_649214.1 LRR 198..537 CDD:443914 11/45 (24%)
leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..356 CDD:275380
leucine-rich repeat 357..381 CDD:275380
leucine-rich repeat 382..397 CDD:275380
leucine-rich repeat 405..430 CDD:275380
leucine-rich repeat 432..453 CDD:275380
leucine-rich repeat 454..477 CDD:275380
leucine-rich repeat 478..501 CDD:275380 2/5 (40%)
leucine-rich repeat 502..525 CDD:275380 7/26 (27%)
TIR 751..891 CDD:214587
AT1G31540NP_001117396.1 PLN03210 1..1156 CDD:215633 20/116 (17%)
leucine-rich repeat 583..606 CDD:275380
leucine-rich repeat 607..629 CDD:275380
leucine-rich repeat 630..652 CDD:275380
leucine-rich repeat 653..676 CDD:275380
leucine-rich repeat 677..699 CDD:275380
leucine-rich repeat 700..720 CDD:275380
leucine-rich repeat 721..775 CDD:275380
leucine-rich repeat 776..799 CDD:275380
leucine-rich repeat 800..833 CDD:275380
leucine-rich repeat 834..866 CDD:275380
leucine-rich repeat 867..901 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.