DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-9 and AT3G04220

DIOPT Version :9

Sequence 1:NP_001246846.1 Gene:Toll-9 / 40245 FlyBaseID:FBgn0036978 Length:900 Species:Drosophila melanogaster
Sequence 2:NP_001326120.1 Gene:AT3G04220 / 819577 AraportID:AT3G04220 Length:896 Species:Arabidopsis thaliana


Alignment Length:482 Identity:103/482 - (21%)
Similarity:176/482 - (36%) Gaps:134/482 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LYLDLSHGNLKDDSDLFREAKLSRKVTIWRTEVFSAAFNTLTAAPFRTLYSM--------RESLK 158
            |:|.|:.....||::|. |.:|.:|.:..|..:...|..:|.....| |..|        ||.::
plant   487 LFLHLACSFHNDDTELV-EQQLGKKFSDLRQGLHVLAEKSLIHMDLR-LIRMHVLLAQLGREIVR 549

  Fly   159 LLSLRGNNFAELIPDAEDFARFVNESRLEASNSVPHHCELLLLHNTTDLYDRECYLYFNNNT--- 220
            ..|:......:.:.||.|....:.:.  ..|.||                   ..:.|:.||   
plant   550 KQSIHEPGQRQFLVDATDIREVLTDD--TGSRSV-------------------IGIDFDFNTMEK 593

  Fly   221 --NMGQSITTGRNYTNFIKVLKDRFDQHG-----------------------------SSSQSIA 254
              ::.:....|.:...||::..|.|.:||                             ...:.:.
plant   594 ELDISEKAFRGMSNLQFIRIYGDLFSRHGVYYFGGRGHRVSLDYDSKLHFPRGLDYLPGKLRLLH 658

  Fly   255 WATFP--KMPR------LVELDISNCSIEYVSKEAFRNVSNLRRLFMSDNKIMTISHDTFYYVQG 311
            |..||  .:|.      ||:|.:....:|    :.:..:..||.|                    
plant   659 WQQFPMTSLPSEFHAEFLVKLCMPYSKLE----KLWEGIQPLRNL-------------------- 699

  Fly   312 VQYLDLSFTNFLTYSYQLQLPTLEMALSLIYGLKIQQNVFKYLPELIYLDLSHSKMTRNSAVAFA 376
             ::|||:.:..|.     :||.|..|.:|      |:...:....|:.|..|..:.|        
plant   700 -EWLDLTCSRNLK-----ELPDLSTATNL------QRLSIERCSSLVKLPSSIGEAT-------- 744

  Fly   377 HLGDKLKFLSL--CYTAIPMVSSTIFKN-TVLEGLDLSGNPYLSYNIIDDAFDGIANTLKYLYFE 438
                .||.::|  |.:.:.:.||  |.| |.|:.|||  ....|...:..:|..:||.....::|
plant   745 ----NLKKINLRECLSLVELPSS--FGNLTNLQELDL--RECSSLVELPTSFGNLANVESLEFYE 801

  Fly   439 RSNIKDLEWS-KSLKNLQVLGLAGNNINALTPAMFQSLESLEILDLSSNHVGNWYRSAFHNNSAL 502
            .|::..|..: .:|.||:||||...:.....|:.|.:|.:|::|:|..........|:|.|.:.|
plant   802 CSSLVKLPSTFGNLTNLRVLGLRECSSMVELPSSFGNLTNLQVLNLRKCSTLVELPSSFVNLTNL 866

  Fly   503 RVLNLRSNTINMLSNEMLKDFERLDYL 529
            ..|:||.     .|:.:...|..:.||
plant   867 ENLDLRD-----CSSLLPSSFGNVTYL 888

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-9NP_001246846.1 leucine-rich repeat 157..185 CDD:275380 4/27 (15%)
LRR_8 262..322 CDD:290566 11/65 (17%)
leucine-rich repeat 264..287 CDD:275380 4/22 (18%)
leucine-rich repeat 288..311 CDD:275380 3/22 (14%)
leucine-rich repeat 312..356 CDD:275380 10/43 (23%)
LRR_8 <344..387 CDD:290566 7/42 (17%)
leucine-rich repeat 357..381 CDD:275380 4/23 (17%)
leucine-rich repeat 382..397 CDD:275380 4/16 (25%)
leucine-rich repeat 405..430 CDD:275380 6/24 (25%)
LRR_8 431..488 CDD:290566 16/57 (28%)
leucine-rich repeat 432..453 CDD:275380 4/21 (19%)
LRR_RI <449..536 CDD:238064 24/81 (30%)
leucine-rich repeat 454..477 CDD:275380 8/22 (36%)
LRR_8 477..536 CDD:290566 14/53 (26%)
leucine-rich repeat 478..501 CDD:275380 6/22 (27%)
leucine-rich repeat 502..525 CDD:275380 6/22 (27%)
TIR 751..891 CDD:214587
AT3G04220NP_001326120.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 44 1.000 Domainoid score I4673
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D282372at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.