DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-9 and AT2G03300

DIOPT Version :9

Sequence 1:NP_001246846.1 Gene:Toll-9 / 40245 FlyBaseID:FBgn0036978 Length:900 Species:Drosophila melanogaster
Sequence 2:NP_178429.1 Gene:AT2G03300 / 814859 AraportID:AT2G03300 Length:203 Species:Arabidopsis thaliana


Alignment Length:132 Identity:29/132 - (21%)
Similarity:52/132 - (39%) Gaps:32/132 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   795 LDNIISCMDRSYSLMLIISSKFLLSHWCQFEMYLAQHRIFEVSKEHLILVF----LEDIPRRKRP 855
            |.|:...:..|...:.|.|:::..|.||..|:...: ::.:..|.|:|.:|    :||:  ||:.
plant    49 LKNLFLRIQESKIALAIFSTRYTESSWCMDELVKIK-KLADKRKLHVIPIFYKVKVEDV--RKQT 110

  Fly   856 K-------TLQYLMDVKTYIKWPTA--------------KEDRKLFWKRLKRSLE----VIGINS 895
            .       ||..:.......||..|              |.|...|.|.:.::::    .||:..
plant   111 GEFGDNFWTLAKVSSGDQIKKWKEALECIPNKMGLSLGDKSDEADFIKEVVKAVQCVVATIGLEE 175

  Fly   896 RE 897
            .|
plant   176 EE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-9NP_001246846.1 leucine-rich repeat 157..185 CDD:275380
LRR_8 262..322 CDD:290566
leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..356 CDD:275380
LRR_8 <344..387 CDD:290566
leucine-rich repeat 357..381 CDD:275380
leucine-rich repeat 382..397 CDD:275380
leucine-rich repeat 405..430 CDD:275380
LRR_8 431..488 CDD:290566
leucine-rich repeat 432..453 CDD:275380
LRR_RI <449..536 CDD:238064
leucine-rich repeat 454..477 CDD:275380
LRR_8 477..536 CDD:290566
leucine-rich repeat 478..501 CDD:275380
leucine-rich repeat 502..525 CDD:275380
TIR 751..891 CDD:214587 26/124 (21%)
AT2G03300NP_178429.1 TIR 8..164 CDD:279864 26/117 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 44 1.000 Domainoid score I4673
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D282372at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.