DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-9 and cDIP

DIOPT Version :9

Sequence 1:NP_001246846.1 Gene:Toll-9 / 40245 FlyBaseID:FBgn0036978 Length:900 Species:Drosophila melanogaster
Sequence 2:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster


Alignment Length:475 Identity:104/475 - (21%)
Similarity:181/475 - (38%) Gaps:126/475 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 KLLSLRGNNFAELIPDAEDFARFVNESRLEASNSVPHHCELLLLHNTTDLYDRE--CYLYFNNNT 220
            |:.|.||..||     .||         .:|:..:|....:.....|.::.|.|  ..|.|.|.|
  Fly    54 KVTSCRGFEFA-----GED---------EKATFDLPTEVRIAEDGTTYEVGDEEHSRTLIFENCT 104

  Fly   221 NMGQSITTGRNYTNF-------IKVLKDRFDQHGSSSQSIAWATFP-KMPRLVELDISNCSIEYV 277
                       :|||       ::|  ...|..|...:.|.|..|. ...:||.|.:|:..||.:
  Fly   105 -----------FTNFPLRLFYTLEV--SELDMRGCGIRFIYWENFSIGADKLVILLLSDNHIEVL 156

  Fly   278 SKEAFRNVSNLRRLFMSDNKIMTISHDTFYYVQGVQYLDLSFTNFLTYSYQLQLPTLE-MALSLI 341
            ..:.||...||..:|::.||:..:....|..:..:|||||:...            || :|..:.
  Fly   157 PTKTFRGAGNLEFIFLNRNKLGKLQAGAFDNLLKLQYLDLTENR------------LEALAADVF 209

  Fly   342 YGLK--------------IQQNVFKYLPELIYLDLSHSKMTRNSAVAFAHLG--DKLKFLSLCYT 390
            .|||              |:.::|.:.|:|:.:.:.::::......||...|  .:::::.|...
  Fly   210 AGLKSLRHVGLAGNQLTTIESDLFAHNPDLLSVAMQNNRLREVGEYAFRSRGRHHQMQYVDLSNN 274

  Fly   391 AIPMV-------SSTIFKNTVLEGLDLSG---NPYLSYNIIDDAFDGIANTLKYLYFERSNIKDL 445
            ...:|       ::...:|..|:.::|.|   |..||.|.:.:.:...:..|::|....:::..|
  Fly   275 PELVVLLLNINATNLTARNCSLDRVNLYGSVTNVDLSDNRVRELYFPASEALEHLVLRNNSLVQL 339

  Fly   446 EWSKSLKNLQVLGLAGN-NINAL-----TPAM-----------------FQSLESLEILDLSSNH 487
            .....:..|:.|.:|.| |:..|     ||.:                 .|.:::|:.||:|.|:
  Fly   340 ASLSRVPRLRHLDVADNPNLGQLPDGWRTPHLEMLVLRNTGQMELPLEALQGMQNLQKLDISGNN 404

  Fly   488 VGNWYRSAFHNNSALRVLNLRSNTINMLSNEMLKDFERLDYLSLGDNDFICDCHLRAVVEVAAAN 552
            :.....|||...:.|....:..|..|..|   |::              |.|..:||.......:
  Fly   405 LTEIDPSAFPTLTQLTHFYIHGNNWNCFS---LRN--------------IMDVLIRANGIAYTVD 452

  Fly   553 NKDAD----------CSYRL 562
            |.|.|          |.|||
  Fly   453 NYDPDFPGEYFHGIACMYRL 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-9NP_001246846.1 leucine-rich repeat 157..185 CDD:275380 8/26 (31%)
LRR_8 262..322 CDD:290566 19/59 (32%)
leucine-rich repeat 264..287 CDD:275380 8/22 (36%)
leucine-rich repeat 288..311 CDD:275380 5/22 (23%)
leucine-rich repeat 312..356 CDD:275380 13/58 (22%)
LRR_8 <344..387 CDD:290566 9/58 (16%)
leucine-rich repeat 357..381 CDD:275380 4/25 (16%)
leucine-rich repeat 382..397 CDD:275380 2/21 (10%)
leucine-rich repeat 405..430 CDD:275380 7/27 (26%)
LRR_8 431..488 CDD:290566 17/79 (22%)
leucine-rich repeat 432..453 CDD:275380 3/20 (15%)
LRR_RI <449..536 CDD:238064 22/109 (20%)
leucine-rich repeat 454..477 CDD:275380 9/45 (20%)
LRR_8 477..536 CDD:290566 13/58 (22%)
leucine-rich repeat 478..501 CDD:275380 8/22 (36%)
leucine-rich repeat 502..525 CDD:275380 5/22 (23%)
TIR 751..891 CDD:214587
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380 6/25 (24%)
LRR_RI 143..407 CDD:238064 59/275 (21%)
leucine-rich repeat 143..166 CDD:275380 8/22 (36%)
LRR_8 166..225 CDD:290566 17/70 (24%)
leucine-rich repeat 167..190 CDD:275380 5/22 (23%)
leucine-rich repeat 191..214 CDD:275380 10/34 (29%)
leucine-rich repeat 215..238 CDD:275380 2/22 (9%)
leucine-rich repeat 239..265 CDD:275380 4/25 (16%)
leucine-rich repeat 266..325 CDD:275380 10/58 (17%)
LRR_8 304..357 CDD:290566 10/52 (19%)
leucine-rich repeat 326..347 CDD:275380 3/20 (15%)
leucine-rich repeat 348..394 CDD:275380 9/45 (20%)
LRR_8 369..428 CDD:290566 11/58 (19%)
LRR_4 393..433 CDD:289563 11/39 (28%)
leucine-rich repeat 395..418 CDD:275380 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453690
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.