DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-9 and CG18249

DIOPT Version :9

Sequence 1:NP_001246846.1 Gene:Toll-9 / 40245 FlyBaseID:FBgn0036978 Length:900 Species:Drosophila melanogaster
Sequence 2:NP_001163549.1 Gene:CG18249 / 40964 FlyBaseID:FBgn0037553 Length:559 Species:Drosophila melanogaster


Alignment Length:426 Identity:107/426 - (25%)
Similarity:156/426 - (36%) Gaps:132/426 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 SSQSIAWATFPKMPRLVELDISNCSIEYVSKEAFRNVSNLRRLFMSDNKIMTISHDTFYYVQGVQ 313
            |.|||.|......|.|..|.|.||:..::|||:.|.|.||..|.|....:..:....|..|..::
  Fly    66 SRQSITWLVLQLTPGLRTLVIRNCATYHISKESLRPVENLTSLQMQGTSLGVLRDQIFNAVPRLE 130

  Fly   314 YLDLSFTNFLTYSYQLQLPTLEMA----LSLIYGLKIQQNVFKY--------LPELIYLDLSHSK 366
            .|.|| .||        :.|:.:|    ||.:..|.:|.|....        |.||::||||.::
  Fly   131 ILQLS-QNF--------IHTVHVAAFQGLSKLRLLGLQGNAIAEILSSTLDPLMELVHLDLSRNE 186

  Fly   367 MTRNSAVAFAH---------------------LGD--KLKFLSLCYTA---IPMVSSTIFKNTVL 405
            :|......||.                     ||.  .|:.|.|.:.|   :..::.|..:|.||
  Fly   187 LTTLPQNIFAKNKKLQTLLLNGNPLRILMPDVLGSLPNLRLLDLGHAAELEVMTLNLTNVQNLVL 251

  Fly   406 EGLDLSGNPYLSYNIIDDAFDGIANTLKYLYFERSNIKDLEWSKSLKNLQV--------LGLAGN 462
            ||..||.      .:|:..|                ||....:..|.:|||        :.|.||
  Fly   252 EGSSLSS------LVINGGF----------------IKLQAGNNELNHLQVGNKSSVIEMDLHGN 294

  Fly   463 NINAL-TPAMFQSLESLEILDLSSNHVGNWYRSAF--HNNS-------------ALRVLNLRSNT 511
            .:|.. |.|:.:.:.:|:.||||.|.:     .|.  |.:.             :|:.|||.:|.
  Fly   295 LLNGNDTAALLRGMWNLQRLDLSKNRI-----EALPQHGSGLDASGTQELLILPSLKFLNLANNQ 354

  Fly   512 INMLSNEMLKDFERLDYLSLGDNDFICDCHLRAVVEVA------------AANNKDADCSYRLLN 564
            :..|..|......||.||.|..|       |...::||            ...|:....:|:.|:
  Fly   355 LVRLPPESPILSSRLSYLDLSHN-------LMLTLDVAILRSLSVLKGLYVEGNRLNTINYQKLH 412

  Fly   565 YSQNAVGEEVISLAESLIIDRKLWQSRYIPWLQRSY 600
                   ||...|:|..:.|.        ||....|
  Fly   413 -------EEHPDLSELGLHDN--------PWSSGLY 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-9NP_001246846.1 leucine-rich repeat 157..185 CDD:275380
LRR_8 262..322 CDD:290566 20/59 (34%)
leucine-rich repeat 264..287 CDD:275380 10/22 (45%)
leucine-rich repeat 288..311 CDD:275380 5/22 (23%)
leucine-rich repeat 312..356 CDD:275380 13/55 (24%)
LRR_8 <344..387 CDD:290566 17/73 (23%)
leucine-rich repeat 357..381 CDD:275380 10/46 (22%)
leucine-rich repeat 382..397 CDD:275380 4/17 (24%)
leucine-rich repeat 405..430 CDD:275380 7/24 (29%)
LRR_8 431..488 CDD:290566 18/65 (28%)
leucine-rich repeat 432..453 CDD:275380 3/20 (15%)
LRR_RI <449..536 CDD:238064 31/110 (28%)
leucine-rich repeat 454..477 CDD:275380 9/31 (29%)
LRR_8 477..536 CDD:290566 21/73 (29%)
leucine-rich repeat 478..501 CDD:275380 8/37 (22%)
leucine-rich repeat 502..525 CDD:275380 7/22 (32%)
TIR 751..891 CDD:214587
CG18249NP_001163549.1 leucine-rich repeat 57..80 CDD:275380 5/13 (38%)
LRR_8 104..163 CDD:290566 18/67 (27%)
leucine-rich repeat 105..128 CDD:275380 5/22 (23%)
LRR_RI 107..438 CDD:238064 89/385 (23%)
leucine-rich repeat 129..152 CDD:275380 8/31 (26%)
leucine-rich repeat 153..176 CDD:275380 4/22 (18%)
LRR_8 176..232 CDD:290566 14/55 (25%)
leucine-rich repeat 177..200 CDD:275380 8/22 (36%)
leucine-rich repeat 201..224 CDD:275380 2/22 (9%)
leucine-rich repeat 225..258 CDD:275380 11/32 (34%)
leucine-rich repeat 259..310 CDD:275380 14/66 (21%)
leucine-rich repeat 311..344 CDD:275380 8/37 (22%)
LRR_8 343..403 CDD:290566 17/66 (26%)
leucine-rich repeat 345..368 CDD:275380 7/22 (32%)
leucine-rich repeat 369..390 CDD:275380 8/27 (30%)
leucine-rich repeat 393..417 CDD:275380 5/30 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453689
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.