DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-9 and CD180

DIOPT Version :9

Sequence 1:NP_001246846.1 Gene:Toll-9 / 40245 FlyBaseID:FBgn0036978 Length:900 Species:Drosophila melanogaster
Sequence 2:NP_005573.2 Gene:CD180 / 4064 HGNCID:6726 Length:661 Species:Homo sapiens


Alignment Length:634 Identity:137/634 - (21%)
Similarity:236/634 - (37%) Gaps:174/634 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WDVIVLVCLFLGNVREAYTEFSIQD-GLIIEPDSATTSSEEAE------EVSKERTDLKSLMLKY 64
            ||   .:|:    .:||...::.:: ||...||:...::|..|      .....|| ...||   
Human    24 WD---QMCI----EKEANKTYNCENLGLSEIPDTLPNTTEFLEFSFNFLPTIHNRT-FSRLM--- 77

  Fly    65 ESDDGNSCLLDLIKDEVIWWQFPNGTLRDSTKKYAHKLYLDLSHGNLKDDSDLFREAKLSRKVTI 129
                 |...|||.:.::.|       :.:.|.:..|:|...:..||   ......|..|:...::
Human    78 -----NLTFLDLTRCQINW-------IHEDTFQSHHQLSTLVLTGN---PLIFMAETSLNGPKSL 127

  Fly   130 WRTEVFSAAFNTLTAAPFRTLYSMRESLKLLSLRGNNFAELIPDAEDF-ARFVNESRLEASNSVP 193
            ....:.....:.|...|...|.:: |||.|    |:|....|...:|| ||  |...|:..|:..
Human   128 KHLFLIQTGISNLEFIPVHNLENL-ESLYL----GSNHISSIKFPKDFPAR--NLKVLDFQNNAI 185

  Fly   194 HHC---ELLLLHNTTDLYDRECYLYFNNNTNMG-----------QSITTG------------RNY 232
            |:.   ::..|....:|     .|.||.|...|           ||:..|            :|.
Human   186 HYISREDMRSLEQAINL-----SLNFNGNNVKGIELGAFDSTIFQSLNFGGTPNLSVIFNGLQNS 245

  Fly   233 TN---FIKVLKDRFDQHGSSS--------------------QSIAWATFPKMPRLVELDISNCSI 274
            |.   ::...:|..|:..||:                    ..|:..||....:|.|||::...:
Human   246 TTQSLWLGTFEDIDDEDISSAMLKGLCEMSVESLNLQEHRFSDISSTTFQCFTQLQELDLTATHL 310

  Fly   275 EYVSKEAFRNVSNLRRLFMSDN---KIMTISHDTF-----YYVQG-----------------VQY 314
            :.: ....:.::.|::|.:|.|   ::..||...|     .|::|                 :|.
Human   311 KGL-PSGMKGLNLLKKLVLSVNHFDQLCQISAANFPSLTHLYIRGNVKKLHLGVGCLEKLGNLQT 374

  Fly   315 LDLSFTNF-LTYSYQLQLPTLE--MALSLIYG--LKIQQNVFKYLPELIYLDLSHSKMTRNSAVA 374
            ||||..:. .:....|||..|.  ..|:|.:.  |.:|...||..|:|..|||:.:::..|:..:
Human   375 LDLSHNDIEASDCCSLQLKNLSHLQTLNLSHNEPLGLQSQAFKECPQLELLDLAFTRLHINAPQS 439

  Fly   375 -FAHLGDKLKFLSLCYTAIPMVSSTIFKN-TVLEGLDLSGNPYLSYNIIDDAFDGIANTLKYLYF 437
             |.:| ..|:.|:|.|..:...:..:... .||..|:|.||                      :|
Human   440 PFQNL-HFLQVLNLTYCFLDTSNQHLLAGLPVLRHLNLKGN----------------------HF 481

  Fly   438 ERSNIKDLEWSKSLKNLQVLGLAGNNINALTPAMFQSLESLEILDLSSN-----------HVGNW 491
            :...|......:::.:|:||.|:...:.::....|.||..:..:|||.|           |:...
Human   482 QDGTITKTNLLQTVGSLEVLILSSCGLLSIDQQAFHSLGKMSHVDLSHNSLTCDSIDSLSHLKGI 546

  Fly   492 YRSAFHNNSALRVLNLRSNTINMLSNEMLKDFERLDYLSLGDNDFICDC 540
            |            |||.:|:||::|..:|....:...::|..|...|.|
Human   547 Y------------LNLAANSINIISPRLLPILSQQSTINLSHNPLDCTC 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-9NP_001246846.1 leucine-rich repeat 157..185 CDD:275380 10/28 (36%)
LRR_8 262..322 CDD:290566 18/84 (21%)
leucine-rich repeat 264..287 CDD:275380 4/22 (18%)
leucine-rich repeat 288..311 CDD:275380 8/30 (27%)
leucine-rich repeat 312..356 CDD:275380 15/48 (31%)
LRR_8 <344..387 CDD:290566 14/43 (33%)
leucine-rich repeat 357..381 CDD:275380 7/24 (29%)
leucine-rich repeat 382..397 CDD:275380 4/14 (29%)
leucine-rich repeat 405..430 CDD:275380 5/24 (21%)
LRR_8 431..488 CDD:290566 13/67 (19%)
leucine-rich repeat 432..453 CDD:275380 2/20 (10%)
LRR_RI <449..536 CDD:238064 23/97 (24%)
leucine-rich repeat 454..477 CDD:275380 7/22 (32%)
LRR_8 477..536 CDD:290566 16/69 (23%)
leucine-rich repeat 478..501 CDD:275380 6/33 (18%)
leucine-rich repeat 502..525 CDD:275380 8/22 (36%)
TIR 751..891 CDD:214587
CD180NP_005573.2 leucine-rich repeat 38..57 CDD:275380 4/18 (22%)
LRR 1 54..75 4/21 (19%)
leucine-rich repeat 58..78 CDD:275380 5/28 (18%)
LRR 2 78..99 6/27 (22%)
leucine-rich repeat 79..102 CDD:275380 5/29 (17%)
LRR_8 102..161 CDD:290566 14/66 (21%)
LRR 3 102..123 5/23 (22%)
leucine-rich repeat 103..126 CDD:275380 5/25 (20%)
LRR 4 126..147 2/20 (10%)
leucine-rich repeat 127..150 CDD:275380 3/22 (14%)
LRR 5 150..171 8/25 (32%)
leucine-rich repeat 151..174 CDD:275380 11/29 (38%)
LRR 6 174..195 4/20 (20%)
leucine-rich repeat 175..195 CDD:275380 3/19 (16%)
leucine-rich repeat 196..234 CDD:275380 10/42 (24%)
LRR 7 201..221 6/24 (25%)
leucine-rich repeat 235..275 CDD:275380 6/39 (15%)
LRR 8 275..296 3/20 (15%)
leucine-rich repeat 276..299 CDD:275380 3/22 (14%)
LRR 9 299..320 4/21 (19%)
leucine-rich repeat 300..322 CDD:275380 4/22 (18%)
LRR 10 322..343 6/20 (30%)
LRR_8 323..382 CDD:290566 14/58 (24%)
leucine-rich repeat 323..371 CDD:275380 9/47 (19%)
LRR_RI 327..541 CDD:238064 53/236 (22%)
LRR 11 346..366 2/19 (11%)
LRR_8 371..432 CDD:290566 20/60 (33%)
LRR 12 371..391 5/19 (26%)
leucine-rich repeat 372..397 CDD:275380 9/24 (38%)
LRR 13 397..418 5/20 (25%)
leucine-rich repeat 398..421 CDD:275380 6/22 (27%)
LRR_8 420..481 CDD:290566 18/83 (22%)
LRR 14 421..442 5/20 (25%)
leucine-rich repeat 422..446 CDD:275380 7/24 (29%)
LRR 15 446..466 4/19 (21%)
leucine-rich repeat 447..470 CDD:275380 4/22 (18%)
LRR 16 470..493 8/44 (18%)
leucine-rich repeat 471..497 CDD:275380 7/47 (15%)
LRR_8 497..555 CDD:290566 17/69 (25%)
LRR 17 497..518 5/20 (25%)
leucine-rich repeat 498..521 CDD:275380 7/22 (32%)
LRR 18 521..544 5/22 (23%)
leucine-rich repeat 522..543 CDD:275380 4/20 (20%)
LRR 19 546..564 8/29 (28%)
TPKR_C2 577..626 CDD:301599 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.