DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-9 and LOC1269216

DIOPT Version :10

Sequence 1:NP_649214.1 Gene:Toll-9 / 40245 FlyBaseID:FBgn0036978 Length:900 Species:Drosophila melanogaster
Sequence 2:XP_307829.3 Gene:LOC1269216 / 1269216 VectorBaseID:AGAMI1_001475 Length:179 Species:Anopheles gambiae


Alignment Length:158 Identity:51/158 - (32%)
Similarity:72/158 - (45%) Gaps:19/158 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   751 YDIFISYCQNDRTWVLNELLPNVE-ETGDVSICLHERDFQIGVTILDNIISCMDRSYSLMLIISS 814
            ||.||||...|..:|..||||..| |..:..||.|.|||..|..|.:.....::.|...::|:|.
Mosquito     5 YDAFISYAHKDEEFVTKELLPRFESEELNFKICWHVRDFMPGEMIANETTKAVEESRRTIIILSL 69

  Fly   815 KFLLSHWCQFEMYLAQHRIFEVSKEHLILVFLEDIP--RRKRPKTLQYLMDVKTYIKWPTAKEDR 877
            .:|.|.|.|.|...|..:........:|.:..:||.  .:..|: ||..:...|||:|     |.
Mosquito    70 NYLESVWGQIEFSTAYLQSLADKCNRVIPIIYQDIGDIEQLDPQ-LQAYLKTNTYIRW-----DD 128

  Fly   878 KLFWKRL------KRSLEVI----GINS 895
            ..||::|      ||.|:.|    .:||
Mosquito   129 PWFWEKLHYAMPHKRRLKGIFSAPSLNS 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-9NP_649214.1 LRR 198..537 CDD:443914
leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..356 CDD:275380
leucine-rich repeat 357..381 CDD:275380
leucine-rich repeat 382..397 CDD:275380
leucine-rich repeat 405..430 CDD:275380
leucine-rich repeat 432..453 CDD:275380
leucine-rich repeat 454..477 CDD:275380
leucine-rich repeat 478..501 CDD:275380
leucine-rich repeat 502..525 CDD:275380
TIR 751..891 CDD:214587 48/148 (32%)
LOC1269216XP_307829.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.