DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-9 and cd180

DIOPT Version :9

Sequence 1:NP_001246846.1 Gene:Toll-9 / 40245 FlyBaseID:FBgn0036978 Length:900 Species:Drosophila melanogaster
Sequence 2:XP_031762487.1 Gene:cd180 / 100489673 XenbaseID:XB-GENE-489949 Length:571 Species:Xenopus tropicalis


Alignment Length:430 Identity:94/430 - (21%)
Similarity:167/430 - (38%) Gaps:106/430 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 FARFVNESRLEASNSVPHHCELLLLHNTTDLYDRECYLYFNNNTNMGQSITTGRNYTNFIKVLKD 241
            |.|.::.:||     .|....|.|::...|.    .::.|.:..::.....:.|.|. .:|.:..
 Frog    66 FQRAISAARL-----FPGPLALELINVKVDW----AHVQFRSMKHLRPLPVSHRQYC-LVKEINS 120

  Fly   242 RFDQHGSSSQSIAWATFPKMPRLVELDISNCSIEYVSKEAFRNVSNLRRLFMSDNKIMTI----- 301
            .|        ::...||.::..:..||::.|:|..:.::.|:|..:|..|.:..|.|:.|     
 Frog   121 LF--------ALYHTTFMRLKCISPLDLTRCNINLLYEDVFQNNIHLNTLVLIGNPILYIAASAF 177

  Fly   302 ----------------SHDTFYYVQGVQYLD-LSF-TNFLTYSYQLQLPTLEMALSLIYGLKIQQ 348
                            ::.||..::.:|:|: ||| .||::   .||||. ...:..:..|..|.
 Frog   178 NGPLALKHLFLQQIPLTNVTFIPLEHLQHLETLSFGNNFIS---SLQLPH-NFPIKNLRVLDFQS 238

  Fly   349 NVFKYLPELIYLDLSHSKMTRNSAVAFAHLGDKLKFLSLCYTAIPMVSSTIFKNTVLEGLDLSGN 413
            |. |    ::..|:...|.:.|.::...  |:.:::          :....|.:..|..|||.||
 Frog   239 NCXK----ILAADVEILKQSNNLSLILK--GNDIEY----------IEPNSFDSVNLYSLDLKGN 287

  Fly   414 PYLSYNIIDD-AFDGIAN---------------TLKYLYFERSNI--------KDLEWSKSLKN- 453
            .....|::.. ||..:..               .||||...|.||        |.|| |::..| 
 Frog   288 RGDLANLLSSTAFSCLTTIQRLDLTGTHVESLPLLKYLNLSRMNINASNENLLKGLE-SQTFLNM 351

  Fly   454 ------------------LQVLGLAGNNINALTPAMFQSLESLEILDLSSNHVGNWYRSAFHNNS 500
                              |:||.|...|:.|:....|..|..|:..||..|.:..:..:||.:.|
 Frog   352 ERPPSIWELYNIFLQALHLEVLILLSCNLTAIEHRAFHKLAKLQYEDLRHNKITIFSSNAFRDLS 416

  Fly   501 ALRVLNLRSNTINMLSNEMLKDFERLDYLSLGDNDFICDC 540
            .:. ||..||.|:.:::.:|.:......::|..|...|.|
 Frog   417 HIH-LNFASNMISDIASHLLHNISGTSAINLSHNPIDCLC 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-9NP_001246846.1 leucine-rich repeat 157..185 CDD:275380 2/7 (29%)
LRR_8 262..322 CDD:290566 18/82 (22%)
leucine-rich repeat 264..287 CDD:275380 6/22 (27%)
leucine-rich repeat 288..311 CDD:275380 7/43 (16%)
leucine-rich repeat 312..356 CDD:275380 15/45 (33%)
LRR_8 <344..387 CDD:290566 8/42 (19%)
leucine-rich repeat 357..381 CDD:275380 4/23 (17%)
leucine-rich repeat 382..397 CDD:275380 0/14 (0%)
leucine-rich repeat 405..430 CDD:275380 9/25 (36%)
LRR_8 431..488 CDD:290566 24/83 (29%)
leucine-rich repeat 432..453 CDD:275380 11/28 (39%)
LRR_RI <449..536 CDD:238064 24/105 (23%)
leucine-rich repeat 454..477 CDD:275380 8/22 (36%)
LRR_8 477..536 CDD:290566 15/58 (26%)
leucine-rich repeat 478..501 CDD:275380 6/22 (27%)
leucine-rich repeat 502..525 CDD:275380 6/22 (27%)
TIR 751..891 CDD:214587
cd180XP_031762487.1 inl_like_NEAT_1 <71..>326 CDD:411101 58/292 (20%)
leucine-rich repeat 138..158 CDD:275380 6/19 (32%)
leucine-rich repeat 159..182 CDD:275380 5/22 (23%)
leucine-rich repeat 183..206 CDD:275380 2/22 (9%)
leucine-rich repeat 207..230 CDD:275380 10/26 (38%)
leucine-rich repeat 231..256 CDD:275380 6/28 (21%)
leucine-rich repeat 257..278 CDD:275380 2/32 (6%)
leucine-rich repeat 279..305 CDD:275380 9/25 (36%)
leucine-rich repeat 322..345 CDD:275380 10/23 (43%)
LRR_8 369..427 CDD:404697 19/58 (33%)
leucine-rich repeat 370..393 CDD:275380 8/22 (36%)
leucine-rich repeat 394..417 CDD:275380 6/22 (27%)
leucine-rich repeat 418..440 CDD:275380 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.