DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and LIPG

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_005258447.1 Gene:LIPG / 9388 HGNCID:6623 Length:536 Species:Homo sapiens


Alignment Length:310 Identity:89/310 - (28%)
Similarity:126/310 - (40%) Gaps:66/310 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 YSVPLLEASKLWKHSRFSKGRKVVILATGWT-NTVNESSAISMISKAFMCRGDVNFVIVDAADYV 160
            :|.||.:.|       |:...|...:..||| :.:.|:....::|.......|.|.|:||.....
Human   106 HSQPLEDCS-------FNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVVVDWLPLA 163

  Fly   161 DTFYAWSALNTDLIGEHIGVGLTHLIELT--PLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAH 223
            ...|..:..||.::|..|...|..|.|..  .|.|:|||                   |:|||||
Human   164 HQLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLI-------------------GYSLGAH 209

  Fly   224 IMGTAGRTFKKLTGKLIPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHT-------NIGILA 281
            :.|.||...|...|    ||||||||.|.|....|...|:..||..||::||       :|||  
Human   210 VAGYAGNFVKGTVG----RITGLDPAGPMFEGADIHKRLSPDDADFVDVLHTYTRSFGLSIGI-- 268

  Fly   282 KRGPLGDVDFYPGGAHPIQPGC-------------LT--IGCSHTRAVEYFAESAYPHQEKNFMG 331
             :.|:|.:|.||.|. ..||||             :|  :.|.|.|||..|.:|.. :|:|....
Human   269 -QMPVGHIDIYPNGG-DFQPGCGLNDVLGSIAYGTITEVVKCEHERAVHLFVDSLV-NQDKPSFA 330

  Fly   332 KKCASWDELRK---RDCSAGIVSPMGY---RMNPQARGIYYVDVNGWPPY 375
            .:|...:..:|   ..|.....:.:||   :|..:.....|:......|:
Human   331 FQCTDSNRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPF 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 88/303 (29%)
LIPGXP_005258447.1 Pancreat_lipase_like 85..376 CDD:238363 88/304 (29%)
lipo_lipase 86..521 CDD:132274 89/310 (29%)
PLAT_LPL 383..519 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145249
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.