DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and Pla1a

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_620237.1 Gene:Pla1a / 85311 RGDID:621261 Length:456 Species:Rattus norvegicus


Alignment Length:318 Identity:93/318 - (29%)
Similarity:132/318 - (41%) Gaps:58/318 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KMHFQYMTPCQNYSVPLLEASKLWKHSRF--SKGRKVVILATGWTNTVNESSAISMISKAFMCRG 147
            |:.|...||.......|:|.....::|.|  |.|.|::|  .|:.....:.|.|:...:|.:...
  Rat    50 KVQFLLFTPSDPGCGQLVEEDSDIRNSEFNASLGTKLII--HGFRALGTKPSWINKFIRALLRAA 112

  Fly   148 DVNFVIVDAADYVDTFYAWSAL-NTDLIGEHIGVGLTHLIELTPLRNIHLIGGFIKESFVSINSG 211
            |.|.:.||.. |..|...:||: |...:...|...|:.|:||.           :.||.:.|   
  Rat   113 DANVIAVDWV-YGSTGMYFSAVENVVKLSLEISRFLSKLLELG-----------VSESSIHI--- 162

  Fly   212 SDFFVGHSLGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHTN 276
                :|.|||||:.|..|..:|...|    ||||||||.|.:.|..:...|..|||..|:.|||:
  Rat   163 ----IGVSLGAHVGGMVGHFYKGQLG----RITGLDPAGPEYTRASLEERLDSGDALFVEAIHTD 219

  Fly   277 IGILAKRGPLGDVDFYPGGAHPIQPGC---LTIG-----CSHTRAVEYF---AESAYPHQEKNFM 330
            ...|..|.|:|.||::..|... ||||   :..|     |.|.|||..:   .|:..|     .|
  Rat   220 TDNLGIRIPVGHVDYFVNGGQD-QPGCPAFIHAGYSYLICDHMRAVHLYISALENTCP-----LM 278

  Fly   331 GKKCASWDELRKRDC------------SAGIVSPMGYRMNPQARGI-YYVDVNGWPPY 375
            ...|||:......||            ..|:|...|.::.|..:.: .|:......||
  Rat   279 AFPCASYKAFLAGDCLDCFNPFLLSCPRIGLVERGGVKIEPLPKEVRVYLQTTSSAPY 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 91/311 (29%)
Pla1aNP_620237.1 Lipase 14..336 CDD:278576 91/316 (29%)
Pancreat_lipase_like 49..332 CDD:238363 91/312 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338893
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.