DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_114470.1 Gene:Pnliprp1 / 84028 RGDID:620792 Length:473 Species:Rattus norvegicus


Alignment Length:382 Identity:94/382 - (24%)
Similarity:141/382 - (36%) Gaps:118/382 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VILLRLGAL--GDIAVDEEGRLTRSWWDAVPRLLTDIATIKANILTAAPLELASNIIDAVCSSTL 70
            |.|..|||.  .::..|..|..:    ||.|...|.|..:|  :|..:|.::.:..:       |
  Rat     7 VSLFLLGAAQGKEVCYDNLGCFS----DAEPWAGTAIRPLK--LLPWSPEKINTRFL-------L 58

  Fly    71 FMDRIPAQITPDIRKMHFQYMTPCQNYSVPLLEASKLWKHSRFSKGRKVVILATGWTNTVNESSA 135
            :.:..|..         ||.:    ..|.||...:     |.|...||...:..|:.:...|:..
  Rat    59 YTNENPTA---------FQTL----QLSDPLTIGA-----SNFQVARKTRFIIHGFIDKGEENWV 105

  Fly   136 ISMISKAFMCRGDVNFVIVDAADYVDTFYAWSALNTDLIGEHIGVGLTHLIE---LTPLRNIHLI 197
            :.|....|... :||.:.||......|.|..:|.|..::|..:...:..|::   .:|.: :|||
  Rat   106 VDMCKNMFQVE-EVNCICVDWKKGSQTTYTQAANNVRVVGAQVAQMIDILVKNYSYSPSK-VHLI 168

  Fly   198 GGFIKESFVSINSGSDFFVGHSLGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCFRREKILPGL 262
                               |||||||:.|.||   .:..|  :.|||||||.:..|........|
  Rat   169 -------------------GHSLGAHVAGEAG---SRTPG--LGRITGLDPVEANFEGTPEEVRL 209

  Fly   263 TRGDAKLVDIIHTNIGILAKRGPL------------GDVDFYPGGAHPIQPGCLT---------- 305
            ...||..||:|||:      ..||            |.:||:|.|...: |||..          
  Rat   210 DPSDADFVDVIHTD------AAPLIPFLGFGTNQMSGHLDFFPNGGQSM-PGCKKNALSQIVDID 267

  Fly   306 ---------IGCSHTRAVEYFAES--------AYPHQEKNFMGKKCASWDELRKRDC 345
                     :.|:|.|:.:|:.||        |||          |||:.:.....|
  Rat   268 GIWSGTRDFVACNHLRSYKYYLESILNPDGFAAYP----------CASYKDFESNKC 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 77/303 (25%)
Pnliprp1NP_114470.1 Lipase 18..353 CDD:395099 89/371 (24%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339034
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.