DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and Pnlip

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_081201.2 Gene:Pnlip / 69060 MGIID:97722 Length:465 Species:Mus musculus


Alignment Length:332 Identity:95/332 - (28%)
Similarity:138/332 - (41%) Gaps:74/332 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 DAVCSSTLFMDR-------IPAQITPDIRKMHFQYMTPCQNYSVPLLEASKLWKHSRFSKGRKVV 120
            ||..|.||  ||       .||||  :.|.:.:....| .||.:...:||.: ::|.|...||..
Mouse    30 DAPWSGTL--DRPLKALPWSPAQI--NTRFLLYTNENP-DNYQLITSDASNI-RNSNFRTNRKTR 88

  Fly   121 ILATGWTNTVNESSAISMISKAFMCRGDVNFVIVDAADYVDTFYAWSALNTDLIGEHIGVGLTHL 185
            |:..|:.:...|:....|....|... .||.:.||......|.|..:..|..::|..:.: |.::
Mouse    89 IIIHGFIDKGEENWLSDMCKNMFRVE-SVNCICVDWKGGSRTTYTQATQNVRVVGAEVAL-LVNV 151

  Fly   186 IELT---PLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAG-RTFKKLTGKLIPRITGL 246
            ::..   .|.|:|||                   |||||:||.|.|| |||     ..|.|||||
Mouse   152 LQSDLGYSLNNVHLI-------------------GHSLGSHIAGEAGKRTF-----GAIGRITGL 192

  Fly   247 DPAKPCFRREKILPGLTRGDAKLVDIIHTNIG-ILAKRG-----PLGDVDFYPGGAHPIQPGCLT 305
            |||:|.|:.......|...||:.||.|||:.| |:...|     .:|.:||:|.|...: |||..
Mouse   193 DPAEPYFQGTPEEVRLDPTDAQFVDAIHTDAGPIIPNLGFGMSQTVGHLDFFPNGGIEM-PGCQK 256

  Fly   306 -------------------IGCSHTRAVEYFAESAYPHQEKNFMGKKCASWDELRKR---DCSAG 348
                               ..|:|.|:.:::.:|..  ....|.|..|:|:......   .|.:|
Mouse   257 NILSQIVDIDGIWEGTRNFAACNHLRSYKFYTDSIV--NPTGFAGFSCSSYSLFTANKCFPCGSG 319

  Fly   349 IVSPMGY 355
            ....||:
Mouse   320 GCPQMGH 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 83/303 (27%)
PnlipNP_081201.2 Lipase 18..352 CDD:278576 95/332 (29%)
Pancreat_lipase_like 51..348 CDD:238363 85/309 (28%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835426
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.