DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and AgaP_AGAP001825

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_001689320.2 Gene:AgaP_AGAP001825 / 5667789 VectorBaseID:AGAP001825 Length:330 Species:Anopheles gambiae


Alignment Length:268 Identity:74/268 - (27%)
Similarity:102/268 - (38%) Gaps:85/268 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NYSVPLLEASKLWKHSRFSKGRKVVILATGWTNTVNESSAISMISKAFMCRGDVNFVIVDAADYV 160
            |:|:||..|...|:....|                 ..||::|....|  ..:.|:.::|...|.
Mosquito    89 NFSLPLTIAIHGWQERNLS-----------------TYSALTMPYLRF--ANNTNYCLLDWRAYS 134

  Fly   161 DTFYAWSA-LNTDLIGEHIGVGLTHLIEL-TPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAH 223
            :..|..:| .:..|:.:::...|.:|..| .||..:.||                   |.|:|..
Mosquito   135 EFGYQIAARQSVPLVAQYLFGFLQNLSLLYFPLERVTLI-------------------GFSMGGQ 180

  Fly   224 IMGTAGRTFKKLTGKLIPR----ITGLDPAKPCF---------RREKILPGLTRGDAKLVDIIHT 275
            |.|        |||||:|.    |..||||.|.|         ||      |...||:.|.:|:|
Mosquito   181 IAG--------LTGKLLPNRIGTIYALDPAGPLFSHPVDIGPKRR------LDASDAQYVQVIYT 231

  Fly   276 NIGILAKRGPL--GDVDFYPG-GAHPIQPGCLTIG-----------CSHTRAVEYFAESAYPHQE 326
            : ...|..|.:  |..:|.|. |.||.|| |...|           |||..||..|..|..|:..
Mosquito   232 S-RYTAGFGKVLDGAQNFLPNKGYHPQQP-CNAKGDGLSELAGALQCSHRYAVSLFVSSLDPNNP 294

  Fly   327 KNFMGKKC 334
              .:||||
Mosquito   295 --IIGKKC 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 74/268 (28%)
AgaP_AGAP001825XP_001689320.2 Abhydrolase 69..330 CDD:304388 74/268 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.