DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and pnliprp2

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001015812.1 Gene:pnliprp2 / 548529 XenbaseID:XB-GENE-5776210 Length:471 Species:Xenopus tropicalis


Alignment Length:278 Identity:76/278 - (27%)
Similarity:111/278 - (39%) Gaps:88/278 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 DVNFVIVDAADYVDTFYAWSALNTDLIGEHIGVGLTHLIELT------PLRNIHLIGGFIKESFV 206
            |||...||........|:.:|.|..::|..:    .|.|:..      ...|:|:|         
 Frog   117 DVNCFCVDWTGGAYALYSQAANNVRVVGAEV----AHFIQFLSNQYGYSAANVHVI--------- 168

  Fly   207 SINSGSDFFVGHSLGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCFRREKILPGLTRGDAKLVD 271
                      |||||:|   .||.|.|:..|  |.||||||||.|.|:.......|.:.||:|||
 Frog   169 ----------GHSLGSH---AAGETGKRTPG--IARITGLDPAGPFFQNTPPEVRLDQSDAQLVD 218

  Fly   272 IIHTNIGILAKRGPL---------GDVDFYPGGAHPIQPGCL-------------------TIGC 308
            :|||:...:.   ||         |.:||||.|...: |||.                   .|.|
 Frog   219 VIHTDASAIF---PLTGFGIGQSVGHLDFYPNGGKNM-PGCKKSPTLKYLDNYRIFKGSKEIIFC 279

  Fly   309 SHTRAVEYFAES--------AYPHQE-KNFMGKKCASWDELRKRDCSAGIVSPMGYR----MNPQ 360
            ||.|:.:::.||        |:|..: |.|  ||...:      .|.:|....||:.    :.|.
 Frog   280 SHIRSYKFYTESILTPDAFVAFPSSDYKTF--KKGTGF------PCPSGGCPLMGHYAEEFLGPT 336

  Fly   361 ARGI-YYVDVNGWPPYGR 377
            :..: ::::.....|:.|
 Frog   337 SGNLSFFLNTGNSEPFAR 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 74/269 (28%)
pnliprp2NP_001015812.1 Lipase 18..352 CDD:278576 74/274 (27%)
PLAT 355..466 CDD:320707 76/278 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.