DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and PNLIPRP2

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_005387.3 Gene:PNLIPRP2 / 5408 HGNCID:9157 Length:469 Species:Homo sapiens


Alignment Length:293 Identity:83/293 - (28%)
Similarity:121/293 - (41%) Gaps:77/293 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 HFQYMTPCQNYSVPLLEASKLWKHSRFSKGRKVVILATGWTNTVNESSAISMISKAFMCRGDVNF 151
            :||.:|..:..::   ||      |.|...||...:..|:.:...:|....|..|.|... .||.
Human    66 NFQLITGTEPDTI---EA------SNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVE-KVNC 120

  Fly   152 VIVDAADYVDTFYAWSALNTDLIGEHIGVGLTHLIELT------PLRNIHLIGGFIKESFVSINS 210
            :.||........|..:..|..::|..    ...||:..      .|.::|:|             
Human   121 ICVDWRHGSRAMYTQAVQNIRVVGAE----TAFLIQALSTQLGYSLEDVHVI------------- 168

  Fly   211 GSDFFVGHSLGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHT 275
                  |||||||....|||   :|.|: :.||||||||.|||:.|.....|...||..||:|||
Human   169 ------GHSLGAHTAAEAGR---RLGGR-VGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHT 223

  Fly   276 N---------IGILAKRGPLGDVDFYPGGAHPIQPGC-------LT------------IGCSHTR 312
            :         .|:..|   :|.:||:|.|...: |||       :|            :.|:|.|
Human   224 DSSPIVPSLGFGMSQK---VGHLDFFPNGGKEM-PGCKKNVLSTITDIDGIWEGIGGFVSCNHLR 284

  Fly   313 AVEYFAESAYPHQEKNFMGKKCASWDELRKRDC 345
            :.||::.|..  ....|:|..|||:||.::..|
Human   285 SFEYYSSSVL--NPDGFLGYPCASYDEFQESKC 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 83/293 (28%)
PNLIPRP2NP_005387.3 Lipase 18..354 CDD:395099 83/293 (28%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 93..105 2/11 (18%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 257..279 1/21 (5%)
PLAT_PL 357..469 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145360
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.