DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and PNLIP

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_000927.1 Gene:PNLIP / 5406 HGNCID:9155 Length:465 Species:Homo sapiens


Alignment Length:350 Identity:89/350 - (25%)
Similarity:133/350 - (38%) Gaps:74/350 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PLELASNIIDAVCSSTLFMDRI---------------PAQITP----DIRKMHFQYMTPCQNYSV 99
            ||...|.::.||....:..:|:               |..|.|    |:......|.....|...
Human     3 PLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTNENPNNFQ 67

  Fly   100 PLLEASKLWKHSRFSKGRKVVILATGWTNTVNESSAISMISKAFMCRGDVNFVIVDAADYVDTFY 164
            .:...|.....|.|...||...:..|:.:...|:...::....|... .||.:.||......|.|
Human    68 EVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVE-SVNCICVDWKGGSRTGY 131

  Fly   165 AWSALNTDLIGEHIGVGLTHLIELTPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAG 229
            ..::.|..::|..:    .:.:|            |::.:| ..:..:...:|||||||..|.||
Human   132 TQASQNIRIVGAEV----AYFVE------------FLQSAF-GYSPSNVHVIGHSLGAHAAGEAG 179

  Fly   230 RTFKKLTGKLIPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHT-------NIGILAKRGPLG 287
            |.    |...|.||||||||:|||:....|..|...|||.||:|||       |:| ......:|
Human   180 RR----TNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLG-FGMSQVVG 239

  Fly   288 DVDFYPGGAHPIQPGCLT-------------------IGCSHTRAVEYFAESAYPHQEKNFMGKK 333
            .:||:|.|...: |||..                   ..|:|.|:.:|:.:|..  ....|.|..
Human   240 HLDFFPNGGVEM-PGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIV--NPDGFAGFP 301

  Fly   334 CASWDELRKR---DCSAGIVSPMGY 355
            |||::.....   .|.:|....||:
Human   302 CASYNVFTANKCFPCPSGGCPQMGH 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 79/299 (26%)
PNLIPNP_000927.1 Lipase 17..352 CDD:278576 84/335 (25%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145366
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.