DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and lipia

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001003499.1 Gene:lipia / 445105 ZFINID:ZDB-GENE-040801-242 Length:454 Species:Danio rerio


Alignment Length:308 Identity:83/308 - (26%)
Similarity:121/308 - (39%) Gaps:60/308 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LLEASKLWKHSRFSKGRKVVILATGWTNTVNESSAISMISKAFMCRGDVNFVIVDAADYVDTFYA 165
            ||...:.:.:|:|:.......|..|:..|.:....:....:..:.|.|:|.::||..........
Zfish    60 LLSHQEPFSNSQFNVSSVTTFLIHGYRPTGSPPVWMKQFVEFLLNRRDMNVIVVDWNRGATNMNY 124

  Fly   166 WSAL-NTDLIGEHIGVGLTHLIELTPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAG 229
            |..: ||..:..:    ||.||:.            :|::  ..|..|...:|.||||||.|..|
Zfish   125 WQVVKNTRKVANN----LTDLIQK------------MKDN--GANLSSIHMIGVSLGAHISGFTG 171

  Fly   230 RTFKKLTGKLIPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHTNIGILAKRGPLGDVDFYP- 293
            ..|....|    |||.||||.|.|........|...||..|:.:||::..|..|..||.:|:|. 
Zfish   172 ANFNGEIG----RITALDPAGPEFNGRPPEDRLDPSDALFVEALHTDMDALGYRNLLGHIDYYAN 232

  Fly   294 GGAHPIQPGC-LTI-------GCSHTRAVEYFAES--------AYPHQE-KNFMGKKCA------ 335
            |||.  |||| .||       .|.|.|:|..:..|        |||.:. .:|....|.      
Zfish   233 GGAD--QPGCPKTILSGSEYFKCDHQRSVFLYMSSVNGSCPIIAYPCESYTDFQDGTCMDCGKFK 295

  Fly   336 -------SWDELRKRDCSAGIVSPMGY----RMNPQARGIYYVDVNGW 372
                   .:|.:|.||....:.....|    :.:|..:..|.||:..|
Zfish   296 SAGCPIFGYDSVRWRDTLVQLEQTRTYFQTNKASPFCKVGYKVDIVSW 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 82/304 (27%)
lipiaNP_001003499.1 Pancreat_lipase_like 43..327 CDD:238363 78/290 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578610
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.