DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and CG6295

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster


Alignment Length:273 Identity:93/273 - (34%)
Similarity:126/273 - (46%) Gaps:34/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SRFSKGRKVVILATGWTNTVNESSAISMISKAFMCRGDVNFVIVD--AADYVDTFYAWSALNTDL 173
            |.|:..........||:::.:|..... :..|:...||:|.:.||  .|..||  ||.|.|....
  Fly    90 SHFNPNHPTRFTIHGWSSSKDEFINYG-VRDAWFTHGDMNMIAVDWGRARSVD--YASSVLAVPG 151

  Fly   174 IGEHIGVGLTHLIELTPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAGRTFKKLTGK 238
            :||.:..    ||..  :|:.|           .:|..:...:|||||||:.|.||:..|  .|:
  Fly   152 VGEQVAT----LINF--MRSNH-----------GLNLDNTMVIGHSLGAHVSGYAGKNVK--NGQ 197

  Fly   239 LIPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHTNIGILAKRGPLGDVDFYPGGAHPIQPGC 303
            | ..|.|||||.|.|..:.....|:..||..|:.|.||.|.|....|:|...|||.|... ||||
  Fly   198 L-HTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTLGFLKPIGKGAFYPNGGKS-QPGC 260

  Fly   304 ---LTIGCSHTRAVEYFAESAYPHQEKNFMGKKCASWDELRKRDCSAGIVS-PMGYRMNP-QARG 363
               ||..|:|:|:|.|:|||.   .|.||...:|..::|...::|.:...| .||...|. ...|
  Fly   261 GVDLTGSCAHSRSVIYYAESV---TENNFPTMRCGDYEEAVAKECGSSYSSVRMGATTNAYMVAG 322

  Fly   364 IYYVDVNGWPPYG 376
            .|||.|....|||
  Fly   323 DYYVPVRSDAPYG 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 89/265 (34%)
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 90/266 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446074
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.759104 Normalized mean entropy S7741
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.