DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and CG4582

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster


Alignment Length:300 Identity:96/300 - (32%)
Similarity:130/300 - (43%) Gaps:55/300 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 VPLLEASKLWKHSRFSKGRKVVILATGWTNTVNESSAISMISKAFMCR-GDVNFVIVD-----AA 157
            |.|.:|:.| :.||||......||..||....|.:....::...|..| |:.|...||     .|
  Fly   146 VNLYDAASL-RRSRFSPFNPTRILIHGWLGNENANMYNELLPAYFDLRNGNYNIFTVDWGRGAIA 209

  Fly   158 DYVDTFYAWSALNTDLIGEHIGVGLTHLIELTPLRNIHLIGGFIKESFVSINSGSDF----FVGH 218
            ||:...|                      .:.|:..:  :..|:  .|:...:|..|    .||.
  Fly   210 DYITASY----------------------RVKPVGQV--LAKFV--DFLHQEAGMRFEDLQLVGF 248

  Fly   219 SLGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHTNIGILAKR 283
            |:|||:.|.||:..:  ||:| ..|..||||.|.||..|....||..||..|:::||::|.....
  Fly   249 SMGAHVAGLAGKHLQ--TGRL-RMIRALDPALPFFRYAKPKERLTAEDADYVEVLHTSVGSYGFD 310

  Fly   284 GPLGDVDFYPG-GAHPIQPGCLTIGCSHTRAVEYFAESAYPHQEKNFMGKKC--ASWDEL-RKRD 344
            .|:|.||||.. |:.  ||||....|||.||...||||....|...|:.:.|  |.|.:| |...
  Fly   311 RPVGHVDFYANWGSQ--QPGCFWHECSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQLTRFHR 373

  Fly   345 C--SAGIVSPMG-------YRMNPQARGIYYVDVNGWPPY 375
            |  ..|::..||       .....|.:|:||...|..|||
  Fly   374 CPKDTGVMQTMGGDLANVSAEFLAQRQGVYYFQTNDQPPY 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 92/293 (31%)
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 92/294 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446086
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.