DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and LPL

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_000228.1 Gene:LPL / 4023 HGNCID:6677 Length:475 Species:Homo sapiens


Alignment Length:279 Identity:83/279 - (29%)
Similarity:120/279 - (43%) Gaps:62/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 FSKGRKVVILATGWTNT-VNESSAISMISKAFMCRGDVNFVIVDAADYVDTFYAWSALNTDLIGE 176
            |:...|..::..|||.| :.||....:::..:....|.|.::||........|..||..|.|:|:
Human    69 FNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQ 133

  Fly   177 HIGVGLTHLIE--LTPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAGRTFKKLTGKL 239
            .:...:..:.|  ..||.|:||:                   |:|||||..|.||    .||.|.
Human   134 DVARFINWMEEEFNYPLDNVHLL-------------------GYSLGAHAAGIAG----SLTNKK 175

  Fly   240 IPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHT--------NIGILAKRGPLGDVDFYPGGA 296
            :.||||||||.|.|...:....|:..||..||::||        :|||   :.|:|.||.||.|.
Human   176 VNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGI---QKPVGHVDIYPNGG 237

  Fly   297 HPIQPGCLTIG-------------------CSHTRAVEYFAESAYPHQEKNFMGKKCASWDELRK 342
             ..|||| .||                   |||.|::..|.:|.. ::|......:|:|.:...|
Human   238 -TFQPGC-NIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLL-NEENPSKAYRCSSKEAFEK 299

  Fly   343 ---RDCSAGIVSPMGYRMN 358
               ..|.....:.:||.:|
Human   300 GLCLSCRKNRCNNLGYEIN 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 83/279 (30%)
LPLNP_000228.1 Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:30559189 32..53
Lipase 33..473 CDD:332983 83/279 (30%)
Essential for determining substrate specificity. /evidence=ECO:0000269|PubMed:7592706 243..266 3/23 (13%)
Important for interaction with lipoprotein particles. /evidence=ECO:0000269|PubMed:27929370 417..421
Important for heparin binding. /evidence=ECO:0000269|PubMed:11342582 430..434
Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:26725083, ECO:0000269|PubMed:30559189 443..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145363
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.