DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and CG10116

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster


Alignment Length:273 Identity:75/273 - (27%)
Similarity:118/273 - (43%) Gaps:41/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SRFSKGRKVVILATGWTNTVNESSAISMISKAFMCRGDVNFVIVDAADYVDTFYAWSALNTDLIG 175
            |.|......|:....|...:: |..|..:..|.:.:.|.|.:.||.::..|        .|::|.
  Fly    48 SSFYAADPTVVTIPRWLGNIS-SPEIPAVVSARLQQQDSNIISVDLSEAND--------ETEIID 103

  Fly   176 E--HIGVGLTHLIELTPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAGRTFKKLTGK 238
            .  .:.:.|.:..:: ||..| |:.||.:                  |||:.|......::..|:
  Fly   104 SVASLVIVLHNQFDM-PLDRI-LVVGFAE------------------GAHLAGGVAAKVQQDLGR 148

  Fly   239 LIPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHTNIGILAKRGPLGDVDFYPGGAHPIQPGC 303
            .:.:||.|||:.......|    |::.||:.|:::|||.|.......||.||:||.|.. .||||
  Fly   149 QLSQITALDPSSGAELDHK----LSQADAEFVEVVHTNAGGEGTWERLGHVDYYPNGGQ-TQPGC 208

  Fly   304 LTIGCSHTRAVEYFAESAYPHQEKNFMGKKCASWDELRKRDCSAGIVSPMGYRMNPQ--ARGIYY 366
            .|..|||.||.|..||...|  |.:|:..:|.|.:.|....|... ...||.:...:  |.|||:
  Fly   209 TTDSCSHERAFELLAEMWSP--ENDFVSARCGSVETLSASSCRWS-THKMGQKQEEEQPASGIYF 270

  Fly   367 VDVNGWPPYGRNS 379
            ::.....|:.|.:
  Fly   271 LETRQSSPFSRGA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 73/262 (28%)
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 73/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446036
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.