DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and CG10163

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster


Alignment Length:309 Identity:77/309 - (24%)
Similarity:133/309 - (43%) Gaps:44/309 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 ITPDIRKMHFQYMTPCQNYSVPLLEASKLWKHSRFSKGRKVVILATGWTNTVNESSAISMISKAF 143
            |.|...::|...:|. |:..:|:...|:: |....:..||.:|....:....:..|....::...
  Fly    77 INPSDARLHVMTITN-QSVELPIKSISQI-KDFDINPERKTLIYVNAFHTADSYFSVQEHLTLLQ 139

  Fly   144 MCRGDVNFVIVD-AADYVDTFYAWSALNTDLIGEHIGVGLTHLIELTPLRNIHLIGGFIKESFVS 207
            ..|.|:|.::|| |.|....:||        :..|:.|....:.:|  ||       .:|::.::
  Fly   140 NSRRDLNVIVVDFAKDVAQLYYA--------VRHHLSVNGYFVYKL--LR-------ALKDAGIA 187

  Fly   208 INSGSDFFVGHSLGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCFRREKILPGLTRGDAKLVDI 272
            :...:  ..|||:||:|.....:.|.|...:|:.::..:|||..| |...||  :.:..|..|.:
  Fly   188 VQDIT--LAGHSVGANIAALGAQLFAKENKQLVGQLLAIDPATMC-RTTDIL--VKQSVALRVVV 247

  Fly   273 IHTNIGILAKRGPLGDVDFYPGG-----AHPIQPGCLTIGCSHTRAVEYFAESAYPHQEKNFMGK 332
            :|....:...|.|||.:|.||.|     ...:||||.:..|||......|.|:..  :.......
  Fly   248 LHGEGDVFGVRVPLGHIDIYPNGIGYFPRRKLQPGCESKICSHMYPFILFMEALI--EGVMIPAT 310

  Fly   333 KCASWDELRKRDC------SAGIVSPMGYRMNPQARGIYYVDVNGWPPY 375
            ||.||.:.|:.||      :.|::.|      ..|:|:|:......||:
  Fly   311 KCESWAKFRQGDCNFQNTINIGLIYP------ANAKGLYFCMTQPNPPF 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 73/296 (25%)
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 71/289 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446021
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007604
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.