DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and CG6472

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster


Alignment Length:383 Identity:114/383 - (29%)
Similarity:165/383 - (43%) Gaps:77/383 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 ILTAAPLELASNIIDAVCSSTLFMDRIP---------AQITPDIRKMHFQYMTPCQNYSVPLLEA 104
            :||||. .|.:.....:..|.:|....|         .:...||:   |...|.....|..||..
  Fly     2 VLTAAS-TLCNVFTFLLAGSPIFYSAAPRGSCSTCCAIKEREDIK---FMLYTSRNRNSAQLLHL 62

  Fly   105 S---KLWKHSRFSKGRKVVILATGWT-NTVNESSAISMISKAFMCRGDVNFVIVDAADYVDTFYA 165
            |   :| ..|.|:....:.|...|:: :...|..:...:..||:.||:.|.:::|          
  Fly    63 SDDARL-AQSNFNFNYPLAIYLHGFSESATGERQSSQELKDAFLRRGNYNVILID---------- 116

  Fly   166 WSAL-----------NTDLIGEHIGVGLTHLIEL-TPLRNIHLIGGFIKESFVSINSGSDFFVGH 218
            |||:           |..:.|.::...|..|::. .|.:.||||                   |.
  Fly   117 WSAMTAVPWYSNAVENLPVSGRYLARFLRFLVDKGYPAKYIHLI-------------------GF 162

  Fly   219 SLGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHTNIGILAKR 283
            ||||.:.|.||:..:: .|..:||||.||||.|.|........|:..||:.||:|||:.|:|...
  Fly   163 SLGAEVAGFAGKQLQE-WGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNP 226

  Fly   284 GPLGDVDFYPGGAHPIQPGC-----------LTIGCSHTRAVEYFAESAYPHQEKNFMGKKCASW 337
            .|:|..||||.|..|:||||           :.:||||.||.|||.||.  .|.:.|..::|...
  Fly   227 APMGHADFYPNGGRPLQPGCAKQNIANNWLGIIVGCSHQRAWEYFVESI--AQPRGFPAQRCEPS 289

  Fly   338 DELRKRDCSAGIVSPMGYRMNPQARGIYYVDVNGWPPYGRNSEN----TVDPRLKTCY 391
            |.........|..:.||...:|:.||.:|:|.|...|:||||..    ::.|||...|
  Fly   290 DMFGICREPGGGPAFMGMGADPRIRGKFYLDTNDAKPFGRNSRARAIVSLAPRLPIAY 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 94/311 (30%)
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 96/315 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446095
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.