DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and CG13282

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster


Alignment Length:322 Identity:88/322 - (27%)
Similarity:127/322 - (39%) Gaps:72/322 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PDIRKMHFQYMTPCQNYSVPL---LEASKLWKHSRFSKGRKVVILATGWTNTVNESSAISMISKA 142
            ||::...:....|.....:.:   ||.|.| ..|.|:......|:..|: |:......:..:.:.
  Fly    75 PDVKYYIYTRHNPMDRQCLHIDESLEKSNL-TDSYFNPRYPTKIIIHGY-NSDMFLHPLQQMREE 137

  Fly   143 FMCRGDVNFVIVDAADYVDTFYAWSAL-----------NTDLIGEHIGVGLTHLIEL---TPLRN 193
            ::.:.|.|.:.||          ||.|           ||    :|.|.....|:|.   |...:
  Fly   138 YLAKADYNIIYVD----------WSILSPGPCYISAVHNT----KHAGTCTAQLVERLVETGNTD 188

  Fly   194 IHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCF----R 254
            ||:|                   |.||||.:.....|   .|:..::|||||||||.|.|    :
  Fly   189 IHVI-------------------GFSLGAQVPNYIAR---NLSSFMLPRITGLDPAMPLFITSGK 231

  Fly   255 REKILPGLTRGDAKLVDIIHTNIGILAKRGPLGDVDFYPGGAHPIQPGC-----LTIGCSHTRAV 314
            .:|:.|    .||..||:||||..:..|....|..|||..|. .:||||     .:..|||.||.
  Fly   232 ADKLDP----SDASYVDVIHTNALVQGKMERCGHADFYMNGG-IMQPGCNGQKINSFACSHQRAP 291

  Fly   315 EYFAESAYPHQEKNFMGKKCASWDELRKRDC-SAGIVSPMGYRMNPQARGIYYVDVNGWPPY 375
            .||.||.  ...|.|.|..|:.:.......| ....:...|..:.|..||::.:|.|...|:
  Fly   292 AYFLESI--RSPKGFWGWACSGYISYLLGMCPPTNFLLEAGENIRPTTRGMFMIDTNDSSPF 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 84/311 (27%)
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 87/320 (27%)
Pancreat_lipase_like 75..347 CDD:238363 86/316 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446033
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.