DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and CG14034

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster


Alignment Length:367 Identity:102/367 - (27%)
Similarity:155/367 - (42%) Gaps:74/367 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NILTA---APLELASNIIDAVCSSTLFMDRIPAQITPDIRKMHFQYMTPCQNYSVPLLEASKL-- 107
            |||..   :.:.|.:.:.|..|.|      :..:|.|:.....:.|....|       |.:||  
  Fly     4 NILVLIGFSSVMLVAGLDDMNCFS------LQNEICPNANISFWLYTKENQ-------EGTKLSV 55

  Fly   108 WKHSRFS----KGRKVVILATGWTNTVNESSAISMISKAFMCRGDVNFVIVDAADYV-DTFYAWS 167
            ::.:||.    |..||:|  .|: |...:.|..:.:...|:.: |.|.:.:|..... :..|..:
  Fly    56 FELNRFEFYHHKPLKVLI--HGF-NGHRDFSPNTQLRPLFLTQ-DYNLISLDYPKLAYEPCYTEA 116

  Fly   168 ALNTDLIGEHIGVGLTHLIE--LTPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAGR 230
            ..|...:.......|..|:|  |..:.::||||                 :|  ||||:.|..|:
  Fly   117 VHNAKYVARCTAQLLRVLLESGLVKIEDLHLIG-----------------LG--LGAHVAGFIGQ 162

  Fly   231 TFKKLTGKLIPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHTNIGILAKRGPLGDVDFYPG- 294
            .   |....:..||.||||||.:..:.....|...|||.||::||::.:|.....:|.||||.. 
  Fly   163 F---LPEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTMLGLLDAVGHVDFYLNM 224

  Fly   295 GAHPIQPGCLTIG------CSHTRAVEYFAESAYPHQEKNFMGKKCASWDELRKRDCSAGIVSP- 352
            |..  ||.|..|.      |.|.||.:|:|||.  .....|.|..|.::....|     ||..| 
  Fly   225 GVS--QPNCGPINKMETHFCYHNRAADYYAESI--SSPSGFYGFYCPNFKSFAK-----GICIPD 280

  Fly   353 -----MGYRMNPQARGIYYVDVNGWPPYGRNSENT-VDPRLK 388
                 ||:.::|:|||.|::|.|..|||.:....| :..:||
  Fly   281 KNIELMGFHVDPKARGRYFLDTNNGPPYAKGENFTSISRQLK 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 86/306 (28%)
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 86/307 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446030
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.759104 Normalized mean entropy S7741
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.