DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and CG18641

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster


Alignment Length:318 Identity:86/318 - (27%)
Similarity:129/318 - (40%) Gaps:54/318 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PDIRKMHFQYMTPCQNYSVPLLEASKLWKHSRFSKGR--KVVILATGWTNTVNESSAISMISKAF 143
            |.|:...:...|..|...:.:|:.:.|: ::.|:...  |::|...|...|::.|..   :.:|:
  Fly    68 PKIQFYLYTRRTQEQPEFIDVLDPNALY-YTHFNPRHPTKIIIHGFGGGRTLSPSPD---LREAY 128

  Fly   144 MCRGDVNFVIVDAADYVD----TFYAWSALNTDL-IGEHIGVGLTHLIELTPLRNIHLIGGFIKE 203
            ...|:.|.:|||.||.|.    :...|:.....| |.:.:.....|...:.| .::|        
  Fly   129 FSVGEYNIIIVDYADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRGVQP-DDLH-------- 184

  Fly   204 SFVSINSGSDFFVGHSLGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCFRREKILPGLTRGDAK 268
                       |:|:|:||||.|......|...||| .|||.|||....:........|...||.
  Fly   185 -----------FIGYSVGAHIAGLVANYLKPEEGKL-GRITALDPTIFFYAGANNSRDLDSTDAH 237

  Fly   269 LVDIIHTNIGILAKRGPLGDVDFYPGGAHPIQPGCL-------TIGCSHTRAVEYFAESAYPHQE 326
            .||::||..|||.:....|..|||..|. ..||.|:       |:.|.||:...||.||.  ...
  Fly   238 FVDVLHTGAGILGQWHSSGHADFYVNGG-TRQPACVGSATLFQTLACDHTKVTPYFIESI--TTT 299

  Fly   327 KNFMGKKCAS-------WDELRKRDCSAGIVSPMGYRMNPQARGIYYVDVNGWPPYGR 377
            :.|....|.:       |.|.:..:...     ||...:.:|||.|||..|...|:.|
  Fly   300 RGFYAGPCPNLFSYLIGWCEPKDSEYVL-----MGEHCSHKARGNYYVTTNAKAPFAR 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 81/305 (27%)
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 83/310 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.759104 Normalized mean entropy S7741
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.