DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and AgaP_AGAP000687

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_559324.4 Gene:AgaP_AGAP000687 / 3289729 VectorBaseID:AGAP000687 Length:375 Species:Anopheles gambiae


Alignment Length:262 Identity:84/262 - (32%)
Similarity:113/262 - (43%) Gaps:47/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 RFSKGRKVVILATGWTNTVNESSAISMISKAFMCRGDVNFVIVDAADYVDTFYAWSALNTDLIGE 176
            :....:.:..|..|||:.||.:.....::......|. |...||.:......|..:|.||..:|.
Mosquito   138 KLDPSKPIAFLTHGWTDNVNRTWVKQTVADYVRLIGG-NICAVDWSPLALVEYNLAARNTPKVGR 201

  Fly   177 HIGVGLTHLIELTPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAGRTFKKLTGKLIP 241
            ::|..:..|          |..||      |||..:  .||||:||||.|.||    ...|..:|
Mosquito   202 YLGKFVQFL----------LTKGF------SINQVT--LVGHSMGAHISGIAG----AYLGGQVP 244

  Fly   242 RITGLDPAKPCFRREKILP-----GLTRGDAKLVDIIHTNIGILAKRGPLGDVDFYP-GGAHPIQ 300
            .:.|||||.|.|  .|.:|     .|.|.|.:.|..|||:..|:.....||..|:|. .||.| |
Mosquito   245 SVIGLDPAGPAF--TKPIPVSTDRRLDRTDGRFVQAIHTDKNIIGTTMNLGHQDYYANSGASP-Q 306

  Fly   301 PGC-------------LTIGCSHTRAVEYFAESAYPHQEKNFMGKKCASWDELRKRDCSAGIVSP 352
            |||             |...|||.:|||||..|.  .::..|.|..|:|:...::.|||||....
Mosquito   307 PGCEFPLVNNDTTKAYLQFICSHFKAVEYFRASL--DRQNIFEGTACSSYYSYKRNDCSAGTKDD 369

  Fly   353 MG 354
            .|
Mosquito   370 FG 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 84/262 (32%)
AgaP_AGAP000687XP_559324.4 Abhydrolase 111..362 CDD:304388 78/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.