DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and Lipi

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_011244435.1 Gene:Lipi / 320355 MGIID:2443868 Length:485 Species:Mus musculus


Alignment Length:310 Identity:95/310 - (30%)
Similarity:137/310 - (44%) Gaps:51/310 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KANILTAAPLELASNIIDAVCSSTLFMDRIPAQITPDIRKMHFQYMTPCQNYSVPLLEASKLWKH 110
            |...|....|...:::.|..|              |.::.....|.......:.||.|::.. .:
Mouse    34 KRTCLEFTKLSAMNSLKDLFC--------------PKVKINLLMYSRGNAKCAEPLFESNNS-LN 83

  Fly   111 SRFSKGRKVVILATGWTNTVNESSAISMISKAFMCRGDVNFVIVDAADYVDTF-YAWSALNTDLI 174
            :||:..:|.|.:..|:....:....:|..:|||:.:.|||.::||......|| |:.:..||..:
Mouse    84 TRFNPAKKTVWIIHGYRPFGSTPVWLSRFTKAFLKQEDVNLIVVDWNQGATTFMYSRAVRNTRRV 148

  Fly   175 GEHIGVGLTHLIELTPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAGRTFKKLTGKL 239
            .|.:...:.:|          ||.|...::|        .|:|.||||||.|..|:.|....|  
Mouse   149 AEILRETIENL----------LIHGASLDNF--------HFIGMSLGAHISGFVGKIFHGQLG-- 193

  Fly   240 IPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHTNIGILAKRGPLGDVDFYP-GGAHPIQPGC 303
              ||||||||.|.|.|:.....|...|||.||:|||:|..|....|.|.:|||| ||.|  ||||
Mouse   194 --RITGLDPAGPQFSRKPSNSRLYYTDAKFVDVIHTDIKSLGIGEPSGHIDFYPNGGKH--QPGC 254

  Fly   304 LT--------IGCSHTRAVEYFAESAYPHQEKNFMGKKCASWDELRKRDC 345
            .|        |.|.|.||: |...:|: ....||:...|.|:.:.:...|
Mouse   255 PTSIFSGTNFIKCDHQRAI-YLFLAAF-ETSCNFVSFPCRSYKDYKNGLC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 89/271 (33%)
LipiXP_011244435.1 Pancreat_lipase_like 57..346 CDD:238363 89/273 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835429
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.759104 Normalized mean entropy S7741
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.