DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and CG5966

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster


Alignment Length:315 Identity:89/315 - (28%)
Similarity:127/315 - (40%) Gaps:80/315 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 KGRKVVILATGWTNTVNESSAISM---ISKAFMC---RGDVNFVIVDAADYVDTFYAWSALNTDL 173
            || |:.:|..|:.    ||..|..   ::||.:.   .|..:.|::|........|..:..|..|
  Fly   110 KG-KIFLLVHGYL----ESGEIPWMWDMAKALLAHEPEGRASVVLIDWGGGASPPYVQAVANIRL 169

  Fly   174 IG---EHIGVGLTHLIELTPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAGRTFKKL 235
            :|   .|:...|...:.|..|.|:|:|                   |||||||:.|.||...:..
  Fly   170 VGAITAHVVHMLYEELRLPNLDNVHII-------------------GHSLGAHLSGYAGYHLQHD 215

  Fly   236 TGKLIPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHTNIGILAKRG-----PLGDVDFYPGG 295
            .|....||||||||.|.|.....:..|.:.||..|||:||:...|.|.|     .||.|||:|.|
  Fly   216 FGLKPARITGLDPAAPLFTDTDPIVRLDKTDAHFVDIVHTDANPLMKGGLGINMRLGHVDFFPNG 280

  Fly   296 AHPIQPGC--------------LT----IGCSHTRAVEYFAESAYPHQEKNFMGKKCASWDELRK 342
            ... .|||              ||    :||:|.|:.:||.||.  ..:..|:|..|.|::..:.
  Fly   281 GFD-NPGCNKKFQDVVKKKTLFLTMQEFLGCNHIRSQQYFTESI--GSQCPFLGITCDSFESFKD 342

  Fly   343 RDCSAGIVSP------MGYR--------------MNPQARGIYYVDVNGWPPYGR 377
            ..|:: ...|      |||.              ....:.|::|:......|:.|
  Fly   343 TKCTS-CEEPGHTCLRMGYHSQEDYQEQVDLGQLQQGDSPGVFYLWTGDSKPFCR 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 87/306 (28%)
CG5966NP_572286.1 Lipase 46..394 CDD:278576 87/311 (28%)
Pancreat_lipase_like 76..390 CDD:238363 87/307 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.