DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and lpl

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_571202.1 Gene:lpl / 30354 ZFINID:ZDB-GENE-990415-139 Length:511 Species:Danio rerio


Alignment Length:301 Identity:88/301 - (29%)
Similarity:126/301 - (41%) Gaps:69/301 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 YMTPCQNYSVPLLEASKLWKHSRFSKGRKVVILATGWTNT-VNESSAISMISKAFMCRGDVNFVI 153
            |:.|.|..|:         |...|:...|..|:..|||.| :.||....:::..:......|.::
Zfish    74 YIVPGQPQSI---------KDCNFNTETKTFIVIHGWTVTGMFESWVPKLVTALYEREPSANVIV 129

  Fly   154 VDAADYVDTFYAWSALNTDLIGEHIGVGLTHL-IELT-PLRNIHLIGGFIKESFVSINSGSDFFV 216
            ||........|..||..|.|:|:.:...:..| .|:. |...:||:                   
Zfish   130 VDWLSRAQQHYPTSASYTKLVGKDVAKFVNWLQAEIDYPWEKLHLL------------------- 175

  Fly   217 GHSLGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHTN----- 276
            |:|||||:.|.||    .||...:.||||:|||.|.|.....|..|:..||..||::|||     
Zfish   176 GYSLGAHVAGIAG----LLTKHKVNRITGMDPAGPTFEYADSLSTLSPDDANFVDVLHTNTRGSP 236

  Fly   277 ---IGILAKRGPLGDVDFYPGGAHPIQPGC---------LTIG---------CSHTRAVEYFAES 320
               |||   :.|:|.:|.||.|. ..||||         .|.|         |||.|::..|.:|
Zfish   237 DRSIGI---QRPVGHIDIYPNGG-TFQPGCDLQNTMLMVATTGLRNMDQIVKCSHERSIHLFIDS 297

  Fly   321 AYPHQEKNFMGKKCASWDELRK---RDCSAGIVSPMGYRMN 358
            .. :|:...|..:|:|.|...|   ..|.....:.:||.:|
Zfish   298 LV-NQDHESMAFRCSSRDSFNKGMCLSCRKNRCNKVGYAVN 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 88/301 (29%)
lplNP_571202.1 lipo_lipase 52..492 CDD:132274 88/301 (29%)
Pancreat_lipase_like 56..353 CDD:238363 88/301 (29%)
PLAT 360..484 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578627
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.