DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and Lipg

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001012759.1 Gene:Lipg / 291437 RGDID:1310740 Length:493 Species:Rattus norvegicus


Alignment Length:302 Identity:85/302 - (28%)
Similarity:122/302 - (40%) Gaps:59/302 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SKLWKHSRFSKGRKVVILATGWTNTVNESSAISMISKAFMCR-GDVNFVIVDAADYVDTFYAWSA 168
            |||.::..|:...|...:..|||.:....|.:..:..|...| .:.|.|:||........|..:.
  Rat    73 SKLLENCGFNMTAKTFFIIHGWTMSGMFESWLHKLVSALQTREKEANVVVVDWLPLAHQLYIDAV 137

  Fly   169 LNTDLIGEHIGVGLTHLIEL--TPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAGRT 231
            .||.::|..:...|..|.|.  ..|.::|||                   |:|||||:.|.||..
  Rat   138 SNTRVVGRRVAGMLNWLQEKGEFSLGDVHLI-------------------GYSLGAHVAGYAGNF 183

  Fly   232 FKKLTGKLIPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHT-------NIGILAKRGPLGDV 289
            .|...|    ||||||||.|.|....|...|:..||..||::||       :|||   |.|:|.:
  Rat   184 VKGTVG----RITGLDPAGPMFEGVDINRRLSPDDADFVDVLHTYTLSFGLSIGI---RMPVGHI 241

  Fly   290 DFYPGGAHPIQPGC---------------LTIGCSHTRAVEYFAESAYPHQEKNFMGKKCASWDE 339
            |.||.|. ..||||               ..:.|.|.|||..|.:|.. :|:|.....:|...:.
  Rat   242 DIYPNGG-DFQPGCGFNDVMGSFAYGTISEMVKCEHERAVHLFVDSLV-NQDKPSFAFQCTDPNR 304

  Fly   340 LRK---RDCSAGIVSPMGY---RMNPQARGIYYVDVNGWPPY 375
            .::   ..|.....:.:||   :|..:.....|:......|:
  Rat   305 FKRGICLSCRKNRCNNIGYNAKKMRKKRNSKMYLKTRAGMPF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 84/295 (28%)
LipgNP_001012759.1 Pancreat_lipase_like 51..342 CDD:238363 84/296 (28%)
lipo_lipase 53..488 CDD:132274 85/302 (28%)
Heparin-binding. /evidence=ECO:0000250 327..339 2/11 (18%)
PLAT_LPL 349..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338941
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.