DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and Lipi

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001099369.1 Gene:Lipi / 288322 RGDID:1310162 Length:476 Species:Rattus norvegicus


Alignment Length:287 Identity:93/287 - (32%)
Similarity:130/287 - (45%) Gaps:51/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 PLLEASKLWKHSRFSKGRKVVILATGWTNTVNESSAISMISKAFMCRGDVNFVIVDAADYVDTF- 163
            ||.|::.. .::||:..:|.:.:..|:....:....|...:|||:.:.|||.::||......|| 
  Rat    74 PLFESNNS-VNARFNPSKKTIWIIHGYRPLGSTPMWIHKFTKAFLKQEDVNLIVVDWNQGATTFI 137

  Fly   164 YAWSALNTDLIGEHIGVGLTHLIELTPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTA 228
            |..:..||..:.|.:...:.:|          ||.|...::|        .|:|.||||||.|..
  Rat   138 YGRAVKNTRKVAEILREYIENL----------LIHGASLDNF--------HFIGMSLGAHICGFV 184

  Fly   229 GRTFKKLTGKLIPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHTN---IGILAKRGPLGDVD 290
            |:.|:...|    ||||||||.|.|..:.....|...|||.||:||::   .|||.   |.|.:|
  Rat   185 GKLFQGQLG----RITGLDPAGPKFSGKPSNCRLDYTDAKFVDVIHSDSQGFGILE---PSGHID 242

  Fly   291 FYPGGAHPIQPGCLT--------IGCSHTRAVEYFAESAYPHQEKNFMGKKCASWDELRKRDCSA 347
            |||.|... ||||.|        |.|.|.|||..|.|:.  ....||:...|.|:     ||..:
  Rat   243 FYPNGGRN-QPGCPTSLLSGMDYIKCDHQRAVHLFLEAF--ETNCNFVSFPCRSY-----RDYKS 299

  Fly   348 GIVSPMG--YRMNPQARGIYYVDVNGW 372
            |:....|  |:.:....||   ..|.|
  Rat   300 GLCVGCGNLYKDSCPRLGI---QANLW 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 91/283 (32%)
LipiNP_001099369.1 Pancreat_lipase_like 57..346 CDD:238363 93/287 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339046
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.