DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and Pnlip

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_037293.2 Gene:Pnlip / 25702 RGDID:3360 Length:465 Species:Rattus norvegicus


Alignment Length:342 Identity:93/342 - (27%)
Similarity:134/342 - (39%) Gaps:78/342 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 DAVCSSTLFMDRIPAQITP----DIRKMHFQYMTPCQ-NYSVPLLEASKLWKHSRFSKGRKVVIL 122
            ||..|.|:  || |.:..|    .|......|....| ||.....:||.: ::|.|...||..|:
  Rat    30 DAPWSGTI--DR-PLKALPWSPAQINTRFLLYTNENQDNYQKITSDASSI-RNSNFKTNRKTRII 90

  Fly   123 ATGWTNTVNESSAISMISKAFMCRGDVNFVIVDAADYVDTFYAWSALNTDLIGEHIGVGLTHLIE 187
            ..|:.:...|:....|....|... .||.:.||........|..:..|..::|..:.: |.::::
  Rat    91 IHGFIDKGEENWLSDMCKNMFKVE-SVNCICVDWKGGSRATYTQATQNVRVVGAEVAL-LVNVLK 153

  Fly   188 ----LTPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAG-RTFKKLTGKLIPRITGLD 247
                .:| .|:|||                   |||||:|:.|.|| |||     ..|.||||||
  Rat   154 SDLGYSP-DNVHLI-------------------GHSLGSHVAGEAGKRTF-----GAIGRITGLD 193

  Fly   248 PAKPCFRREKILPGLTRGDAKLVDIIHT-------NIGILAKRGPLGDVDFYPGGAHPIQPGCLT 305
            .|:|.|:.......|...||:.||.|||       |:| ......:|.:||:|.|...: |||..
  Rat   194 AAEPYFQGTPEEVRLDPTDAQFVDAIHTDAAPIIPNLG-FGMSQTVGHLDFFPNGGMEM-PGCQK 256

  Fly   306 -------------------IGCSHTRAVEYFAESAYPHQEKNFMGKKCASWDELRKRDCSAGIVS 351
                               ..|:|.|:.:|:.:|..  ....|.|..|:|::......|     .
  Rat   257 NILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIV--NPTGFSGFSCSSYNVFSANKC-----F 314

  Fly   352 PMGYRMNPQARGIYYVD 368
            |.|....||..  :|.|
  Rat   315 PCGSEGCPQMG--HYAD 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 84/316 (27%)
PnlipNP_037293.2 Lipase 17..352 CDD:395099 93/342 (27%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339043
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.