DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and Lpl

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_036730.1 Gene:Lpl / 24539 RGDID:3017 Length:474 Species:Rattus norvegicus


Alignment Length:279 Identity:84/279 - (30%)
Similarity:118/279 - (42%) Gaps:62/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 FSKGRKVVILATGWTNT-VNESSAISMISKAFMCRGDVNFVIVDAADYVDTFYAWSALNTDLIGE 176
            |:...|..::..|||.| :.||....:::..:....|.|.::||........|..||..|.|:|.
  Rat    69 FNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLYRAQQHYPVSAGYTKLVGN 133

  Fly   177 HIGVGLTHLIE--LTPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAGRTFKKLTGKL 239
            .:...:..|.|  ..||.|:||:                   |:|||||..|.||    .||.|.
  Rat   134 DVARFINWLEEEFNYPLDNVHLL-------------------GYSLGAHAAGVAG----SLTNKK 175

  Fly   240 IPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHT--------NIGILAKRGPLGDVDFYPGGA 296
            :.||||||||.|.|...:....|:..||..||::||        :|||   :.|:|.||.||.|.
  Rat   176 VNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGI---QKPVGHVDIYPNGG 237

  Fly   297 HPIQPGCLTIG-------------------CSHTRAVEYFAESAYPHQEKNFMGKKCASWDELRK 342
             ..|||| .||                   |||.|::..|.:|.. ::|......:|.|.:...|
  Rat   238 -TFQPGC-NIGEAIRVIAEKGLGDVDQLVKCSHERSIHLFIDSLL-NEENPSKAYRCNSKEAFEK 299

  Fly   343 ---RDCSAGIVSPMGYRMN 358
               ..|.....:.:||.:|
  Rat   300 GLCLSCRKNRCNNVGYEIN 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 84/279 (30%)
LplNP_036730.1 Interaction with GPIHBP1. /evidence=ECO:0000250|UniProtKB:P06858 32..53
lipo_lipase 33..472 CDD:132274 84/279 (30%)
Pancreat_lipase_like 37..334 CDD:238363 84/279 (30%)
Essential for determining substrate specificity. /evidence=ECO:0000250|UniProtKB:P06858 243..266 3/23 (13%)
PLAT_LPL 341..465 CDD:238856
Important for interaction with lipoprotein particles. /evidence=ECO:0000250|UniProtKB:P06858 417..421
Important for heparin binding. /evidence=ECO:0000250|UniProtKB:P06858 430..434
Interaction with GPIHBP1. /evidence=ECO:0000250|UniProtKB:P06858 443..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339040
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.