DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_035258.2 Gene:Pnliprp2 / 18947 MGIID:1336202 Length:482 Species:Mus musculus


Alignment Length:314 Identity:90/314 - (28%)
Similarity:132/314 - (42%) Gaps:83/314 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PAQITP------DIRKMHFQYMTPCQNYSVPLLEASKLWKHSRFSKGRKVVILATGWTNTVNESS 134
            |::|.|      |.|.:.:....| .||.:...........|.|...||...:..|:.:...|..
Mouse    54 PSKIFPWSPEDIDTRFLLYTNENP-NNYQIISATDPATINASNFQLDRKTRFIIHGFIDKGEEGW 117

  Fly   135 AISMISKAFMCRGDVNFVIVDAADYVDTFYAWSALNTDLIGEHIGVGLTHLIEL-------TPLR 192
            .:.|..|.|... .||.:.||......|.|..::.||.::|..|    ..|:::       :| .
Mouse   118 LLDMCKKMFQVE-KVNCICVDWKRGSRTEYTQASYNTRVVGAEI----AFLVQVLSTEMGYSP-E 176

  Fly   193 NIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCFRREK 257
            |:|||                   |||||:|:.|.|||   :|.|. :.||||||||:|||:.  
Mouse   177 NVHLI-------------------GHSLGSHVAGEAGR---RLEGH-VGRITGLDPAEPCFQG-- 216

  Fly   258 ILPGLTR---GDAKLVDIIHTN---------IGILAKRGPLGDVDFYPGGAHPIQPGC-----LT 305
             ||...|   .||..||:|||:         .|:..|   :|.:||:|.|...: |||     .|
Mouse   217 -LPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQK---VGHLDFFPNGGKEM-PGCQKNILST 276

  Fly   306 I--------------GCSHTRAVEYFAESAYPHQEKNFMGKKCASWDELRKRDC 345
            |              .|:|.|:.:|:|.|..  ....|:|..|:|:::.:..||
Mouse   277 IVDINGIWEGTRNFAACNHLRSYKYYASSIL--NPDGFLGYPCSSYEKFQHNDC 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 85/299 (28%)
Pnliprp2NP_035258.2 Lipase 31..367 CDD:278576 90/314 (29%)
Pancreat_lipase_like 65..363 CDD:238363 87/303 (29%)
Required for galactolipase activity. /evidence=ECO:0000250|UniProtKB:P54317 106..118 2/11 (18%)
Required for galactolipase activity. /evidence=ECO:0000250|UniProtKB:P54317 270..292 2/21 (10%)
PLAT_PL 370..482 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835423
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.