DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and AgaP_AGAP011683

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_320829.4 Gene:AgaP_AGAP011683 / 1280955 VectorBaseID:AGAP011683 Length:580 Species:Anopheles gambiae


Alignment Length:288 Identity:83/288 - (28%)
Similarity:124/288 - (43%) Gaps:57/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 KHSRFSKGRKVVILATGWTNTVNESSAI-SMISKAFMCRGDVNFVIVD------AADYVDTFYAW 166
            ::|.|...........||..  .|:|.: :.|.:.::..||.|.:.||      .|:|:      
Mosquito    17 QNSNFVASHPTRFTIHGWNG--GETSGLHANIRQNYLSVGDYNVIAVDWGAGAQTANYI------ 73

  Fly   167 SALN-TDLIGEHIGVGLTHLIEL--TPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTA 228
            :|.| ...:|:.|...:..|:..  |...||:||                   |||||||..|.|
Mosquito    74 AARNRVASVGDIISRMVNTLVSATGTSRNNIYLI-------------------GHSLGAHAAGNA 119

  Fly   229 GRTFKKLTGKLIPRITGLDPAKPCFR---REKILPGLTRGDAKLVDIIHTNIGILAKRGPLGDVD 290
            |    |:....:..|.|||||.|.|.   .:.:.|    .||:..:.:.||.|:|....||.|.:
Mosquito   120 G----KMQNGQLNTIVGLDPAGPLFSLSDSDIMAP----RDAQYTEAVFTNAGLLGFDLPLSDAN 176

  Fly   291 FYPGGAHPIQPGC---LTIGCSHTRAVEYFAESAYPHQEKNFMGKKCASWDELRKRDCSAGIVSP 352
            |||.|... ||||   ::..|:|:||.|.:|||.  .....|...:||:..|:....|:....:.
Mosquito   177 FYPNGGRS-QPGCGIDVSGNCAHSRAHELYAESV--STTVGFRATRCANHGEIVAGQCTPTGNAN 238

  Fly   353 MGYRMNPQARGI---YYVDVNGWPPYGR 377
            ||...:.|.||:   :.|..||..|:.:
Mosquito   239 MGGEPSNQGRGVNGMFIVSTNGNSPFAQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 80/279 (29%)
AgaP_AGAP011683XP_320829.4 Pancreat_lipase_like 1..259 CDD:238363 80/279 (29%)
Pancreat_lipase_like 322..579 CDD:238363
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.