DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and AgaP_AGAP009103

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_319853.3 Gene:AgaP_AGAP009103 / 1280055 VectorBaseID:AGAP009103 Length:225 Species:Anopheles gambiae


Alignment Length:223 Identity:66/223 - (29%)
Similarity:89/223 - (39%) Gaps:48/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 FSKGRKVVILATGWTNTVNESSAISMISKAFMCRGDVNFVIVDAADYVDTFYAWSALNTDLIGEH 177
            |...::..|:..|:..| ..|..|..:..|::.| ..|...||          |..|:       
Mosquito    19 FKTNQQTAIIIHGFNGT-QTSRHIMFLKDAYLSR-KFNVFAVD----------WEVLS------- 64

  Fly   178 IGVGLTHLIELTPLRNIHLIG-------GFIKESFVSINSGSDFFVGHSLGAHIMGTAGRTFKKL 235
                 .:....:.|.|..|:.       .|:  :|....|.....|||||||||.|.......|.
Mosquito    65 -----QYPCYFSSLSNTKLVSQCTAQLYSFL--TFAGCTSKQITCVGHSLGAHICGMMSNHLTKK 122

  Fly   236 TGKLIPRITGLDPAKPCFRR---EKILPGLTRGDAKLVDIIHTNIGILAKRGPLGDVDFYPGGAH 297
            ..|:|    |||||:|...:   :|.  .|||.||:.|.|||||.|:|.:....|.|||...|..
Mosquito   123 QYKII----GLDPARPLIEKHASKKF--RLTRDDARSVQIIHTNAGLLGQSSFSGRVDFCINGGQ 181

  Fly   298 PIQPGC-----LTIGCSHTRAVEYFAES 320
             :||.|     ....|||..:|.|.|.:
Mosquito   182 -VQPYCEGDRIKQARCSHFLSVCYLANA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 66/223 (30%)
AgaP_AGAP009103XP_319853.3 Abhydrolase 6..222 CDD:304388 66/223 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.