DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and AgaP_AGAP007991

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_317476.4 Gene:AgaP_AGAP007991 / 1277958 VectorBaseID:AGAP007991 Length:587 Species:Anopheles gambiae


Alignment Length:242 Identity:77/242 - (31%)
Similarity:108/242 - (44%) Gaps:47/242 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SRFSKGRKVVILATGWTNTVNESSAISMISKAFMCRGDVNFVIVDAADY----VDTFYAWSALNT 171
            :.|.|||.:::|..|:|.. .:.:....|..|:....:.|.:.|   ||    ::..|..:..|.
Mosquito    20 ANFIKGRPLIVLIHGYTGH-RDYAPNPTIRPAYFAYDEFNIISV---DYNPLALEPCYLQAVRNL 80

  Fly   172 DLIGEHIGVGLTHLI--ELTPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAGRTFKK 234
            ..:.......|..:|  ::.||.:||:                   ||.|||..   |:|.....
Mosquito    81 PTVANCTAQLLDFIISSDIIPLDDIHV-------------------VGFSLGGQ---TSGMIANY 123

  Fly   235 LTGKLIPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHTNI---GILAKRGPLGDVDFYPGGA 296
            |....:.||||||||||.|........|.:.||:.|.:|||::   |||   .|.|..|||..|.
Mosquito   124 LRAGRLKRITGLDPAKPLFVFASNEYKLDQTDAEFVQVIHTDVFQRGIL---HPSGHTDFYVNGG 185

  Fly   297 HPIQPGC-----LTIG-CSHTRAVEYFAESAYPHQEKNFMGKKCASW 337
             .:||||     :|.| |:|.||.||:|||.  ..|..|.|.:||.|
Mosquito   186 -VVQPGCDATTMMTTGECNHNRAPEYYAESI--GTEVGFYGYRCAHW 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 77/242 (32%)
AgaP_AGAP007991XP_317476.4 Pancreat_lipase_like 1..265 CDD:238363 77/242 (32%)
Pancreat_lipase_like 337..586 CDD:238363
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.