DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and AgaP_AGAP000309

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_310814.5 Gene:AgaP_AGAP000309 / 1271953 VectorBaseID:AGAP000309 Length:944 Species:Anopheles gambiae


Alignment Length:258 Identity:75/258 - (29%)
Similarity:104/258 - (40%) Gaps:65/258 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 YAWSALNTDLIGEHIGVGLTHLIELTPLR--NIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMG 226
            |..:|.||.|:|..:.:.|..|.....||  .:|||                   |.|||:|...
Mosquito   275 YVRAAANTRLVGRQLALLLRLLRTHNGLRLSRVHLI-------------------GFSLGSHRTA 320

  Fly   227 TAGR------TFKKLTGKLIPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHTN-----IGIL 280
            .||.      |.:..:...:.||||||||.|.|..:.....|..|||:.||:||:|     :|.|
Mosquito   321 RAGNPSAHPGTERPASRAGLWRITGLDPAGPLFEAQPPEVRLDAGDARYVDVIHSNGENLILGGL 385

  Fly   281 AKRGPLGDVDFYPGGAHPIQPGC--LTIG------------------CSHTRAVEYFAESAYPHQ 325
            ....|:|.||:||.|.. :|.||  |.:|                  |:|.||.::|.:|..|  
Mosquito   386 GSWQPMGTVDYYPNGGR-VQHGCTNLFVGAVTDIIWAPPTTVEGRSLCNHRRAYKFFIDSVAP-- 447

  Fly   326 EKNFMGKKCASWDELRKRDC-------SAGIVSPMGYRMNPQARGIY---YVDVNGWPPYGRN 378
            ..:|....|.|:|:....:|       :......|||....:..|.|   |:......||..|
Mosquito   448 RCHFPAFPCESYDQFAAGECFDCGNGTARSACGRMGYYATSRDVGGYGQLYLRTRDEEPYCAN 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 72/248 (29%)
AgaP_AGAP000309XP_310814.5 Lipase 138..507 CDD:278576 72/253 (28%)
Pancreat_lipase_like 226..503 CDD:238363 72/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.