DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and PNLIPRP3

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001011709.2 Gene:PNLIPRP3 / 119548 HGNCID:23492 Length:467 Species:Homo sapiens


Alignment Length:282 Identity:74/282 - (26%)
Similarity:113/282 - (40%) Gaps:94/282 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 DVNFVIVD----AADYVDTFYAWSALNTDLIGEHIGVGLTHLI---ELTPLRNIHLIGGFIKESF 205
            |:|.:.:|    :.:|:.     :..|..::|..:...:..|:   |.:|.: :|||        
Human   115 DINCINLDWINGSREYIH-----AVNNLRVVGAEVAYFIDVLMKKFEYSPSK-VHLI-------- 165

  Fly   206 VSINSGSDFFVGHSLGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCFRREKILPGLTRGDAKLV 270
                       |||||||:.|.||   .::.|  :.||||||||.|.|........|...||..|
Human   166 -----------GHSLGAHLAGEAG---SRIPG--LGRITGLDPAGPFFHNTPKEVRLDPSDANFV 214

  Fly   271 DIIHTNIG-ILAKRG-----PLGDVDFYP-GGAHPIQPGCLTI--------------------GC 308
            |:||||.. ||.:.|     ..|.:|||| ||.|  .|||..:                    .|
Human   215 DVIHTNAARILFELGVGTIDACGHLDFYPNGGKH--MPGCEDLITPLLKFNFNAYKKEMASFFDC 277

  Fly   309 SHTRAVEYFAES--------AYPHQEKNFMGKKCASWDELRKRDC---------SAGIVSPMGYR 356
            :|.|:.:::|||        |||          |.|:...:..:|         :.|..:...:.
Human   278 NHARSYQFYAESILNPDAFIAYP----------CRSYTSFKAGNCFFCSKEGCPTMGHFADRFHF 332

  Fly   357 MNPQARGI-YYVDVNGWPPYGR 377
            .|.:..|. |:::.....|:.|
Human   333 KNMKTNGSHYFLNTGSLSPFAR 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 72/273 (26%)
PNLIPRP3NP_001011709.2 Lipase 18..352 CDD:278576 72/278 (26%)
Pancreat_lipase_like 52..348 CDD:238363 72/274 (26%)
PLAT_PL 355..467 CDD:238857 74/282 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145264
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.