powered by:
Protein Alignment CG5665 and nat8.6
DIOPT Version :9
Sequence 1: | NP_001246844.1 |
Gene: | CG5665 / 40243 |
FlyBaseID: | FBgn0036977 |
Length: | 395 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004911369.1 |
Gene: | nat8.6 / 101731538 |
XenbaseID: | XB-GENE-22166529 |
Length: | 299 |
Species: | Xenopus tropicalis |
Alignment Length: | 74 |
Identity: | 17/74 - (22%) |
Similarity: | 30/74 - (40%) |
Gaps: | 12/74 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 119 VVILATGWTNTVNESSAISM---------ISKAFMCRGDVNFVIVDA-ADYVDTFYAWSALNTD- 172
|.:||.|:....:|...::. |.|::|...:..|.:.:. ...|.|..|..:.:.|
Frog 148 VALLAAGFYGLYSEFHGVASHALRNDMLDIEKSYMMSENACFWVAEIDRKVVGTVGAQPSTDADD 212
Fly 173 -LIGEHIGV 180
|:..||.|
Frog 213 ELLLLHISV 221
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165164968 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.