DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5665 and nat8.6

DIOPT Version :9

Sequence 1:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_004911369.1 Gene:nat8.6 / 101731538 XenbaseID:XB-GENE-22166529 Length:299 Species:Xenopus tropicalis


Alignment Length:74 Identity:17/74 - (22%)
Similarity:30/74 - (40%) Gaps:12/74 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 VVILATGWTNTVNESSAISM---------ISKAFMCRGDVNFVIVDA-ADYVDTFYAWSALNTD- 172
            |.:||.|:....:|...::.         |.|::|...:..|.:.:. ...|.|..|..:.:.| 
 Frog   148 VALLAAGFYGLYSEFHGVASHALRNDMLDIEKSYMMSENACFWVAEIDRKVVGTVGAQPSTDADD 212

  Fly   173 -LIGEHIGV 180
             |:..||.|
 Frog   213 ELLLLHISV 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 17/74 (23%)
nat8.6XP_004911369.1 Acetyltransf_1 193..271 CDD:278980 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165164968
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.